Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4449288..4449889 | Replicon | chromosome |
| Accession | NZ_HG326223 | ||
| Organism | Serratia marcescens subsp. marcescens Db11 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A8B4GSJ7 |
| Locus tag | SMDB11_RS20695 | Protein ID | WP_025304766.1 |
| Coordinates | 4449288..4449668 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8B4GSF3 |
| Locus tag | SMDB11_RS20700 | Protein ID | WP_025304767.1 |
| Coordinates | 4449668..4449889 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMDB11_RS20670 | 4444535..4445815 | + | 1281 | WP_025304764.1 | DUF3748 domain-containing protein | - |
| SMDB11_RS20675 | 4445846..4446193 | - | 348 | WP_016929593.1 | YceK/YidQ family lipoprotein | - |
| SMDB11_RS20680 | 4446503..4446916 | + | 414 | WP_004933919.1 | heat shock chaperone IbpA | - |
| SMDB11_RS20685 | 4447023..4447451 | + | 429 | WP_004933922.1 | heat shock chaperone IbpB | - |
| SMDB11_RS20690 | 4447619..4449277 | + | 1659 | WP_025304765.1 | putative transporter | - |
| SMDB11_RS20695 | 4449288..4449668 | - | 381 | WP_025304766.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| SMDB11_RS20700 | 4449668..4449889 | - | 222 | WP_025304767.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| SMDB11_RS20705 | 4449964..4451214 | - | 1251 | WP_025304768.1 | valine--pyruvate transaminase | - |
| SMDB11_RS20710 | 4451350..4453413 | - | 2064 | WP_025304769.1 | alpha-amylase | - |
| SMDB11_RS24830 | 4453610..4453762 | + | 153 | WP_162837931.1 | hypothetical protein | - |
| SMDB11_RS20715 | 4453764..4454741 | - | 978 | WP_025304770.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14241.66 Da Isoelectric Point: 7.3173
>T285001 WP_025304766.1 NZ_HG326223:c4449668-4449288 [Serratia marcescens subsp. marcescens Db11]
MVAQRALFDTNILIDYLNGIPQARDVLVEYHINPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIIWATAQVGFRMLISRNPKDFGTDNGVLMPYRL
MVAQRALFDTNILIDYLNGIPQARDVLVEYHINPAISAITWMEVMVGAKKQGPALELKTRQFLGQFLLLPITDEVAERAV
ELRHSQHVKLPDAIIWATAQVGFRMLISRNPKDFGTDNGVLMPYRL
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4GSJ7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4GSF3 |