Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3485623..3486292 | Replicon | chromosome |
| Accession | NZ_HG326223 | ||
| Organism | Serratia marcescens subsp. marcescens Db11 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | SMDB11_RS16305 | Protein ID | WP_025304123.1 |
| Coordinates | 3485623..3486045 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A8G2G4M4 |
| Locus tag | SMDB11_RS16310 | Protein ID | WP_004931679.1 |
| Coordinates | 3486026..3486292 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMDB11_RS16285 | 3481512..3482030 | + | 519 | WP_025304119.1 | flavodoxin FldB | - |
| SMDB11_RS16290 | 3482068..3483432 | - | 1365 | WP_025304120.1 | cell envelope integrity protein CreD | - |
| SMDB11_RS16295 | 3483513..3484931 | - | 1419 | WP_025304121.1 | two-component system sensor histidine kinase CreC | - |
| SMDB11_RS16300 | 3484928..3485623 | - | 696 | WP_025304122.1 | two-component system response regulator CreB | - |
| SMDB11_RS16305 | 3485623..3486045 | - | 423 | WP_025304123.1 | protein YgfX | Toxin |
| SMDB11_RS16310 | 3486026..3486292 | - | 267 | WP_004931679.1 | FAD assembly factor SdhE | Antitoxin |
| SMDB11_RS16315 | 3486613..3487605 | + | 993 | WP_025304124.1 | tRNA-modifying protein YgfZ | - |
| SMDB11_RS16320 | 3487644..3488141 | - | 498 | WP_025304125.1 | DUF2165 domain-containing protein | - |
| SMDB11_RS16325 | 3488292..3488966 | - | 675 | WP_025304126.1 | hemolysin III family protein | - |
| SMDB11_RS16330 | 3489150..3489758 | + | 609 | WP_025304127.1 | HD domain-containing protein | - |
| SMDB11_RS16335 | 3489798..3490724 | - | 927 | WP_025304128.1 | ribokinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16525.62 Da Isoelectric Point: 10.8432
>T285000 WP_025304123.1 NZ_HG326223:c3486045-3485623 [Serratia marcescens subsp. marcescens Db11]
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGYGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGLLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGNGEEP
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGYGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGLLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGNGEEP
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|