Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3118530..3119186 | Replicon | chromosome |
| Accession | NZ_HG326223 | ||
| Organism | Serratia marcescens subsp. marcescens Db11 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A656VD00 |
| Locus tag | SMDB11_RS14600 | Protein ID | WP_025303864.1 |
| Coordinates | 3118530..3118919 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8G2LCA8 |
| Locus tag | SMDB11_RS14605 | Protein ID | WP_004941563.1 |
| Coordinates | 3118923..3119186 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMDB11_RS14585 | 3114997..3116427 | + | 1431 | WP_025303862.1 | MFS transporter | - |
| SMDB11_RS14590 | 3116424..3117806 | + | 1383 | WP_025303863.1 | two-component system sensor histidine kinase BaeS | - |
| SMDB11_RS14595 | 3117806..3118522 | + | 717 | WP_004941568.1 | two-component system response regulator BaeR | - |
| SMDB11_RS14600 | 3118530..3118919 | - | 390 | WP_025303864.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| SMDB11_RS14605 | 3118923..3119186 | - | 264 | WP_004941563.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| SMDB11_RS14610 | 3119524..3119862 | + | 339 | WP_016926703.1 | YegP family protein | - |
| SMDB11_RS14615 | 3120041..3121393 | + | 1353 | WP_025303865.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
| SMDB11_RS24710 | 3121610..3121831 | - | 222 | WP_141998673.1 | hypothetical protein | - |
| SMDB11_RS14620 | 3121861..3122766 | + | 906 | WP_025303866.1 | lipid kinase YegS | - |
| SMDB11_RS14625 | 3122935..3124149 | + | 1215 | WP_025303867.1 | D-galactonate dehydratase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14351.67 Da Isoelectric Point: 9.5570
>T284998 WP_025303864.1 NZ_HG326223:c3118919-3118530 [Serratia marcescens subsp. marcescens Db11]
MYMFDTNTVSHLFRQHPQVLNVMQKLPPSAVCISSVTEAELLYGVAKRRNKALQSMVEAFLAAVTVYAWDREAARCYGEM
RANMGRKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
MYMFDTNTVSHLFRQHPQVLNVMQKLPPSAVCISSVTEAELLYGVAKRRNKALQSMVEAFLAAVTVYAWDREAARCYGEM
RANMGRKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|