Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 3028789..3029351 | Replicon | chromosome |
Accession | NZ_HG326223 | ||
Organism | Serratia marcescens subsp. marcescens Db11 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | SMDB11_RS14185 | Protein ID | WP_025303801.1 |
Coordinates | 3028789..3029145 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | A0A8G2G5I1 |
Locus tag | SMDB11_RS14190 | Protein ID | WP_004936539.1 |
Coordinates | 3029142..3029351 (-) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SMDB11_RS14165 | 3024525..3025322 | - | 798 | WP_025303797.1 | energy transducer TonB | - |
SMDB11_RS14170 | 3025425..3026264 | - | 840 | WP_025303798.1 | ChaN family lipoprotein | - |
SMDB11_RS14175 | 3026442..3027851 | + | 1410 | WP_025303799.1 | S-methylmethionine permease | - |
SMDB11_RS14180 | 3027841..3028779 | + | 939 | WP_025303800.1 | homocysteine S-methyltransferase | - |
SMDB11_RS14185 | 3028789..3029145 | - | 357 | WP_025303801.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
SMDB11_RS14190 | 3029142..3029351 | - | 210 | WP_004936539.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
SMDB11_RS14195 | 3029461..3031740 | - | 2280 | WP_016926766.1 | NADP-dependent oxaloacetate-decarboxylating malate dehydrogenase | - |
SMDB11_RS24825 | 3031956..3032129 | - | 174 | WP_038629816.1 | hypothetical protein | - |
SMDB11_RS14205 | 3032110..3032490 | - | 381 | WP_025303802.1 | DUF2570 family protein | - |
SMDB11_RS14210 | 3032487..3032888 | - | 402 | WP_025303803.1 | M15 family metallopeptidase | - |
SMDB11_RS14215 | 3032878..3033204 | - | 327 | WP_004936551.1 | phage holin, lambda family | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13163.93 Da Isoelectric Point: 4.9139
>T284997 WP_025303801.1 NZ_HG326223:c3029145-3028789 [Serratia marcescens subsp. marcescens Db11]
MIFLTAEDIAEFNAEIVPHGRQEGSKVEAVANRVLNAYHYENVTDVYRLAALYLIAISHGHIFLDGNKRTAFQSMALFLG
INGIALREDAELVEITVEAAQGRLNVEQAAEHLRRLTE
MIFLTAEDIAEFNAEIVPHGRQEGSKVEAVANRVLNAYHYENVTDVYRLAALYLIAISHGHIFLDGNKRTAFQSMALFLG
INGIALREDAELVEITVEAAQGRLNVEQAAEHLRRLTE
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|