Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2748573..2749185 | Replicon | chromosome |
| Accession | NZ_HG326223 | ||
| Organism | Serratia marcescens subsp. marcescens Db11 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | D2TUP9 |
| Locus tag | SMDB11_RS12775 | Protein ID | WP_012906750.1 |
| Coordinates | 2748573..2748752 (+) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | SMDB11_RS12780 | Protein ID | WP_025303565.1 |
| Coordinates | 2748775..2749185 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMDB11_RS12750 | 2744580..2744864 | + | 285 | WP_019453645.1 | 50S ribosomal protein L25 | - |
| SMDB11_RS12755 | 2744949..2745956 | - | 1008 | WP_025303563.1 | nucleoid-associated protein YejK | - |
| SMDB11_RS12760 | 2746167..2746394 | + | 228 | WP_004935782.1 | YejL family protein | - |
| SMDB11_RS12765 | 2746404..2748185 | + | 1782 | WP_025303564.1 | LPS biosynthesis-modulating metalloenzyme YejM | - |
| SMDB11_RS12775 | 2748573..2748752 | + | 180 | WP_012906750.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| SMDB11_RS12780 | 2748775..2749185 | + | 411 | WP_025303565.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| SMDB11_RS12785 | 2749240..2750355 | + | 1116 | WP_025303566.1 | acyltransferase | - |
| SMDB11_RS24225 | 2750330..2750746 | - | 417 | WP_071826130.1 | tail fiber assembly protein | - |
| SMDB11_RS24690 | 2751925..2752152 | - | 228 | Protein_2561 | phage tail protein | - |
| SMDB11_RS12795 | 2752139..2752726 | - | 588 | WP_025303568.1 | DUF2313 domain-containing protein | - |
| SMDB11_RS12800 | 2752730..2753803 | - | 1074 | WP_025303569.1 | baseplate J/gp47 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2741628..2787752 | 46124 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6644.85 Da Isoelectric Point: 10.9132
>T284996 WP_012906750.1 NZ_HG326223:2748573-2748752 [Serratia marcescens subsp. marcescens Db11]
MDSRNAIAMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQAGL
MDSRNAIAMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14902.72 Da Isoelectric Point: 4.2855
>AT284996 WP_025303565.1 NZ_HG326223:2748775-2749185 [Serratia marcescens subsp. marcescens Db11]
MLYPVAIDKGDSSFGVRVPDIPGCFSGGDNYQDAIESAREAIEAHIELLVEDGEAVPEGTNVENWLSDPDYAGVVWALVD
VDITRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRVAADRVISRENR
MLYPVAIDKGDSSFGVRVPDIPGCFSGGDNYQDAIESAREAIEAHIELLVEDGEAVPEGTNVENWLSDPDYAGVVWALVD
VDITRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRVAADRVISRENR
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|