Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 850689..851236 | Replicon | chromosome |
| Accession | NZ_HG326223 | ||
| Organism | Serratia marcescens subsp. marcescens Db11 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | A0A380ADA6 |
| Locus tag | SMDB11_RS04115 | Protein ID | WP_025302144.1 |
| Coordinates | 850928..851236 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | SMDB11_RS04110 | Protein ID | WP_025302143.1 |
| Coordinates | 850689..850925 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMDB11_RS04095 | 847175..848710 | + | 1536 | WP_025302140.1 | glutathione ABC transporter substrate-binding protein GsiB | - |
| SMDB11_RS04100 | 848763..849683 | + | 921 | WP_025302141.1 | glutathione ABC transporter permease GsiC | - |
| SMDB11_RS04105 | 849693..850601 | + | 909 | WP_169540348.1 | glutathione ABC transporter permease GsiD | - |
| SMDB11_RS04110 | 850689..850925 | + | 237 | WP_025302143.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| SMDB11_RS04115 | 850928..851236 | + | 309 | WP_025302144.1 | CcdB family protein | Toxin |
| SMDB11_RS04120 | 851276..852118 | - | 843 | WP_015377214.1 | S-formylglutathione hydrolase | - |
| SMDB11_RS04125 | 852133..853257 | - | 1125 | WP_016928454.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
| SMDB11_RS04130 | 853287..854207 | - | 921 | WP_025302145.1 | LysR family transcriptional regulator | - |
| SMDB11_RS04135 | 854313..855470 | + | 1158 | WP_025302146.1 | YbfB/YjiJ family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11504.32 Da Isoelectric Point: 5.0196
>T284990 WP_025302144.1 NZ_HG326223:850928-851236 [Serratia marcescens subsp. marcescens Db11]
MQFTVYDNTYPASAYPYLLDVQSDLIDVLSTRLMIPLYALDNVRVKISARLCPEIEVNGEKFLVMTHEMAAVRISQIGKA
VGNVNEHRNQIKAAIDFLIDGF
MQFTVYDNTYPASAYPYLLDVQSDLIDVLSTRLMIPLYALDNVRVKISARLCPEIEVNGEKFLVMTHEMAAVRISQIGKA
VGNVNEHRNQIKAAIDFLIDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|