Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 388995..389617 | Replicon | chromosome |
| Accession | NZ_HG326223 | ||
| Organism | Serratia marcescens subsp. marcescens Db11 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A8B4G7F9 |
| Locus tag | SMDB11_RS01810 | Protein ID | WP_004940313.1 |
| Coordinates | 388995..389198 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A2X2G5J9 |
| Locus tag | SMDB11_RS01815 | Protein ID | WP_004940312.1 |
| Coordinates | 389249..389617 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMDB11_RS01785 | 384694..385032 | + | 339 | WP_004940327.1 | P-II family nitrogen regulator | - |
| SMDB11_RS01790 | 385069..386355 | + | 1287 | WP_038628958.1 | ammonium transporter AmtB | - |
| SMDB11_RS01795 | 386446..387309 | - | 864 | WP_016928847.1 | acyl-CoA thioesterase II | - |
| SMDB11_RS01800 | 387541..388032 | + | 492 | WP_025301777.1 | YbaY family lipoprotein | - |
| SMDB11_RS01805 | 388097..388411 | - | 315 | WP_025301778.1 | MGMT family protein | - |
| SMDB11_RS01810 | 388995..389198 | - | 204 | WP_004940313.1 | hemolysin expression modulator Hha | Toxin |
| SMDB11_RS01815 | 389249..389617 | - | 369 | WP_004940312.1 | Hha toxicity modulator TomB | Antitoxin |
| SMDB11_RS01820 | 389776..390129 | - | 354 | WP_025301779.1 | hypothetical protein | - |
| SMDB11_RS01825 | 390538..391251 | + | 714 | WP_025301780.1 | ABC transporter ATP-binding protein | - |
| SMDB11_RS01830 | 391248..392105 | + | 858 | WP_025301781.1 | metal ABC transporter permease | - |
| SMDB11_RS01835 | 392131..393009 | + | 879 | WP_025301782.1 | metal ABC transporter substrate-binding protein | - |
| SMDB11_RS01840 | 393118..393258 | - | 141 | WP_004940304.1 | type B 50S ribosomal protein L36 | - |
| SMDB11_RS01845 | 393271..393525 | - | 255 | WP_004940303.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8107.37 Da Isoelectric Point: 6.9756
>T284989 WP_004940313.1 NZ_HG326223:c389198-388995 [Serratia marcescens subsp. marcescens Db11]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14261.95 Da Isoelectric Point: 4.4314
>AT284989 WP_004940312.1 NZ_HG326223:c389617-389249 [Serratia marcescens subsp. marcescens Db11]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4G7F9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2X2G5J9 |