Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 388995..389617 Replicon chromosome
Accession NZ_HG326223
Organism Serratia marcescens subsp. marcescens Db11

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag SMDB11_RS01810 Protein ID WP_004940313.1
Coordinates 388995..389198 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag SMDB11_RS01815 Protein ID WP_004940312.1
Coordinates 389249..389617 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SMDB11_RS01785 384694..385032 + 339 WP_004940327.1 P-II family nitrogen regulator -
SMDB11_RS01790 385069..386355 + 1287 WP_038628958.1 ammonium transporter AmtB -
SMDB11_RS01795 386446..387309 - 864 WP_016928847.1 acyl-CoA thioesterase II -
SMDB11_RS01800 387541..388032 + 492 WP_025301777.1 YbaY family lipoprotein -
SMDB11_RS01805 388097..388411 - 315 WP_025301778.1 MGMT family protein -
SMDB11_RS01810 388995..389198 - 204 WP_004940313.1 hemolysin expression modulator Hha Toxin
SMDB11_RS01815 389249..389617 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
SMDB11_RS01820 389776..390129 - 354 WP_025301779.1 hypothetical protein -
SMDB11_RS01825 390538..391251 + 714 WP_025301780.1 ABC transporter ATP-binding protein -
SMDB11_RS01830 391248..392105 + 858 WP_025301781.1 metal ABC transporter permease -
SMDB11_RS01835 392131..393009 + 879 WP_025301782.1 metal ABC transporter substrate-binding protein -
SMDB11_RS01840 393118..393258 - 141 WP_004940304.1 type B 50S ribosomal protein L36 -
SMDB11_RS01845 393271..393525 - 255 WP_004940303.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T284989 WP_004940313.1 NZ_HG326223:c389198-388995 [Serratia marcescens subsp. marcescens Db11]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT284989 WP_004940312.1 NZ_HG326223:c389617-389249 [Serratia marcescens subsp. marcescens Db11]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References