Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 5920718..5921292 | Replicon | chromosome |
| Accession | NZ_HG322949 | ||
| Organism | Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | GJA_RS26970 | Protein ID | WP_081905584.1 |
| Coordinates | 5920718..5920900 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | W0VEJ6 |
| Locus tag | GJA_RS25705 | Protein ID | WP_038498072.1 |
| Coordinates | 5920909..5921292 (+) | Length | 128 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GJA_RS26400 | 5916979..5917576 | + | 598 | Protein_5122 | type VI secretion system tip protein VgrG | - |
| GJA_RS26405 | 5917613..5918710 | + | 1098 | Protein_5123 | type VI secretion system Vgr family protein | - |
| GJA_RS25700 | 5919193..5919366 | + | 174 | Protein_5124 | transposase domain-containing protein | - |
| GJA_RS27635 | 5919856..5920257 | + | 402 | WP_144241646.1 | hypothetical protein | - |
| GJA_RS26970 | 5920718..5920900 | + | 183 | WP_081905584.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| GJA_RS25705 | 5920909..5921292 | + | 384 | WP_038498072.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| GJA_RS25720 | 5923079..5923750 | + | 672 | Protein_5128 | IS66 family transposase | - |
| GJA_RS27645 | 5923950..5924349 | + | 400 | Protein_5129 | type VI secretion system tip protein VgrG | - |
| GJA_RS25730 | 5924362..5924892 | - | 531 | WP_038498083.1 | hypothetical protein | - |
| GJA_RS25735 | 5924953..5925459 | + | 507 | WP_038498086.1 | DUF2875 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 5904777..5945179 | 40402 | |
| - | inside | IScluster/Tn | - | - | 5919181..5923774 | 4593 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6713.77 Da Isoelectric Point: 10.9132
>T284981 WP_081905584.1 NZ_HG322949:5920718-5920900 [Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628]
MNSADIIKQLKSDGWEHVSTRGSHHKYRNPKTGKSVIVPHPKKDLPIGTVNSILKQAQLK
MNSADIIKQLKSDGWEHVSTRGSHHKYRNPKTGKSVIVPHPKKDLPIGTVNSILKQAQLK
Download Length: 183 bp
Antitoxin
Download Length: 128 a.a. Molecular weight: 14130.97 Da Isoelectric Point: 4.6647
>AT284981 WP_038498072.1 NZ_HG322949:5920909-5921292 [Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628]
MLYPLYVWKDANSAYGASFPDLPGVNTAADELHDLSKAAQEAVEVMYDRETNIPAASAIEKWTSNPDYADGFWMLVNIDL
SKVNTKPVRLNISLPESLLRDIDQFAKSHHLTRSGFLAQAAMRAMAE
MLYPLYVWKDANSAYGASFPDLPGVNTAADELHDLSKAAQEAVEVMYDRETNIPAASAIEKWTSNPDYADGFWMLVNIDL
SKVNTKPVRLNISLPESLLRDIDQFAKSHHLTRSGFLAQAAMRAMAE
Download Length: 384 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|