Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ParST/Xre(antitoxin) |
Location | 1705245..1705867 | Replicon | chromosome |
Accession | NZ_HG322949 | ||
Organism | Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628 |
Toxin (Protein)
Gene name | ParT | Uniprot ID | W0V2T7 |
Locus tag | GJA_RS07255 | Protein ID | WP_038490472.1 |
Coordinates | 1705245..1705553 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ParS | Uniprot ID | - |
Locus tag | GJA_RS07260 | Protein ID | WP_038498979.1 |
Coordinates | 1705550..1705867 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GJA_RS07230 | 1701154..1701729 | + | 576 | WP_038490460.1 | elongation factor P | - |
GJA_RS07235 | 1701952..1702389 | + | 438 | WP_061301549.1 | hypothetical protein | - |
GJA_RS26020 | 1702466..1702921 | + | 456 | WP_051780403.1 | hypothetical protein | - |
GJA_RS07245 | 1703021..1703806 | - | 786 | WP_038490466.1 | helix-turn-helix transcriptional regulator | - |
GJA_RS07250 | 1703995..1705152 | + | 1158 | WP_197539828.1 | MFS transporter | - |
GJA_RS07255 | 1705245..1705553 | - | 309 | WP_038490472.1 | RES family NAD+ phosphorylase | Toxin |
GJA_RS07260 | 1705550..1705867 | - | 318 | WP_038498979.1 | MbcA/ParS/Xre antitoxin family protein | Antitoxin |
GJA_RS07265 | 1706207..1708282 | - | 2076 | WP_038490475.1 | AAA family ATPase | - |
GJA_RS27965 | 1708788..1708982 | - | 195 | WP_174525960.1 | hypothetical protein | - |
GJA_RS07275 | 1709291..1710262 | + | 972 | WP_038490477.1 | ornithine cyclodeaminase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 10901.38 Da Isoelectric Point: 7.4015
>T284978 WP_038490472.1 NZ_HG322949:c1705553-1705245 [Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628]
MTVALWRIAATTATYEANDLSGTGAKHTGGRWNPVGWDANPAGMTSVQAGEAWLKGKASALLVVPSVIVPEESNILINPL
HPDAAAITATPLRKWHHDARYF
MTVALWRIAATTATYEANDLSGTGAKHTGGRWNPVGWDANPAGMTSVQAGEAWLKGKASALLVVPSVIVPEESNILINPL
HPDAAAITATPLRKWHHDARYF
Download Length: 309 bp
Antitoxin
Download Length: 106 a.a. Molecular weight: 11349.04 Da Isoelectric Point: 6.2980
>AT284978 WP_038498979.1 NZ_HG322949:c1705867-1705550 [Janthinobacterium agaricidamnosum NBRC 102515 = DSM 9628]
MPKEALMDSLGLSRATINRKVLRAQPLSREESERVVGMQSLIGQVQAMIDADSAPDFDAARWLARWLAEPLPVLGGNTPG
SYISTVEGQKYVGKLLAMTQSGAYA
MPKEALMDSLGLSRATINRKVLRAQPLSREESERVVGMQSLIGQVQAMIDADSAPDFDAARWLARWLAEPLPVLGGNTPG
SYISTVEGQKYVGKLLAMTQSGAYA
Download Length: 318 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|