Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2989174..2989799 | Replicon | chromosome |
Accession | NZ_HF572917 | ||
Organism | Escherichia coli strain HUSEC2011 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | HUS2011_RS16090 | Protein ID | WP_000911329.1 |
Coordinates | 2989174..2989572 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | HUS2011_RS16095 | Protein ID | WP_000450524.1 |
Coordinates | 2989572..2989799 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HUS2011_RS16070 | 2985052..2985252 | + | 201 | WP_000383836.1 | YpfN family protein | - |
HUS2011_RS16075 | 2985362..2986060 | - | 699 | WP_000679823.1 | esterase | - |
HUS2011_RS16080 | 2986134..2988149 | - | 2016 | WP_000829294.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
HUS2011_RS16085 | 2988164..2989027 | - | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
HUS2011_RS16090 | 2989174..2989572 | - | 399 | WP_000911329.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
HUS2011_RS16095 | 2989572..2989799 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
HUS2011_RS16100 | 2989954..2990667 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
HUS2011_RS16110 | 2990880..2991914 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
HUS2011_RS16115 | 2991931..2992809 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
HUS2011_RS16120 | 2992955..2993527 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
HUS2011_RS16125 | 2993527..2993997 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T284965 WP_000911329.1 NZ_HF572917:c2989572-2989174 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |