Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 514352..514970 | Replicon | chromosome |
Accession | NZ_HF572917 | ||
Organism | Escherichia coli strain HUSEC2011 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | HUS2011_RS03420 | Protein ID | WP_001291435.1 |
Coordinates | 514352..514570 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | HUS2011_RS03425 | Protein ID | WP_000344800.1 |
Coordinates | 514596..514970 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HUS2011_RS03390 | 509642..510214 | + | 573 | WP_000779826.1 | lipoprotein | - |
HUS2011_RS03395 | 510245..510556 | - | 312 | WP_000409911.1 | MGMT family protein | - |
HUS2011_RS03400 | 510935..511288 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
HUS2011_RS03405 | 511330..512880 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
HUS2011_RS03410 | 513044..513514 | - | 471 | WP_000136192.1 | YlaC family protein | - |
HUS2011_RS03415 | 513630..514181 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
HUS2011_RS03420 | 514352..514570 | - | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
HUS2011_RS03425 | 514596..514970 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
HUS2011_RS03430 | 515516..518665 | - | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
HUS2011_RS03435 | 518688..519881 | - | 1194 | WP_001386618.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T284957 WP_001291435.1 NZ_HF572917:c514570-514352 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT284957 WP_000344800.1 NZ_HF572917:c514970-514596 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |