Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 480056..480893 | Replicon | chromosome |
Accession | NZ_HF572917 | ||
Organism | Escherichia coli strain HUSEC2011 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | HUS2011_RS03250 | Protein ID | WP_000227784.1 |
Coordinates | 480056..480598 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | HUS2011_RS03255 | Protein ID | WP_001297137.1 |
Coordinates | 480582..480893 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HUS2011_RS03230 | 475595..476506 | - | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
HUS2011_RS03235 | 476674..477165 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
HUS2011_RS03240 | 477293..478657 | - | 1365 | WP_001000974.1 | MFS transporter | - |
HUS2011_RS03245 | 479065..480000 | + | 936 | WP_024174603.1 | sel1 repeat family protein | - |
HUS2011_RS03250 | 480056..480598 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
HUS2011_RS03255 | 480582..480893 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
HUS2011_RS03260 | 481078..481968 | - | 891 | WP_000971336.1 | heme o synthase | - |
HUS2011_RS03265 | 481980..482309 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
HUS2011_RS03270 | 482309..482923 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
HUS2011_RS03275 | 482913..484904 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
HUS2011_RS03280 | 484926..485873 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T284956 WP_000227784.1 NZ_HF572917:c480598-480056 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|