Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 4859836..4860479 | Replicon | chromosome |
Accession | NZ_HF571988 | ||
Organism | Yersinia enterocolitica (type O:5) str. YE53/03 isolate host faecal sample |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | YE5303_RS22540 | Protein ID | WP_046051923.1 |
Coordinates | 4859836..4860255 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A0E1NFG4 |
Locus tag | YE5303_RS22545 | Protein ID | WP_005161959.1 |
Coordinates | 4860252..4860479 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
YE5303_RS22520 | 4855108..4855977 | + | 870 | WP_046051920.1 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
YE5303_RS22525 | 4856104..4856727 | + | 624 | WP_013650637.1 | superoxide dismutase [Mn] | - |
YE5303_RS22530 | 4857047..4858996 | + | 1950 | WP_046051921.1 | methyl-accepting chemotaxis protein | - |
YE5303_RS22535 | 4859075..4859746 | + | 672 | WP_046051922.1 | 6-N-hydroxylaminopurine resistance protein | - |
YE5303_RS22540 | 4859836..4860255 | - | 420 | WP_046051923.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
YE5303_RS22545 | 4860252..4860479 | - | 228 | WP_005161959.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
YE5303_RS22550 | 4860611..4860967 | - | 357 | WP_005161962.1 | YibL family ribosome-associated protein | - |
YE5303_RS22555 | 4861060..4862541 | - | 1482 | WP_046051924.1 | PLP-dependent aminotransferase family protein | - |
YE5303_RS22560 | 4862685..4863296 | + | 612 | WP_046051925.1 | LysE family translocator | - |
YE5303_RS22565 | 4863293..4863847 | - | 555 | WP_005161972.1 | MltR family transcriptional regulator | - |
YE5303_RS22570 | 4863944..4865104 | - | 1161 | WP_046051926.1 | mannitol-1-phosphate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15580.20 Da Isoelectric Point: 9.0596
>T284954 WP_046051923.1 NZ_HF571988:c4860255-4859836 [Yersinia enterocolitica (type O:5) str. YE53/03]
MIKKLYMLDTNICSFIMRERPAELIIKLQQCIEHQNKIVVSAITYSEMRFGAIGKKASPKHNYLVDEFVKRLDAILPWDV
AAVDATTNIKVELAKQGTPIGGNDAAIAGHAVSAGAILVTNNIREFERVKKLRIEDWTQ
MIKKLYMLDTNICSFIMRERPAELIIKLQQCIEHQNKIVVSAITYSEMRFGAIGKKASPKHNYLVDEFVKRLDAILPWDV
AAVDATTNIKVELAKQGTPIGGNDAAIAGHAVSAGAILVTNNIREFERVKKLRIEDWTQ
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|