Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4443664..4444422 Replicon chromosome
Accession NZ_HF571988
Organism Yersinia enterocolitica (type O:5) str. YE53/03 isolate host faecal sample

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag YE5303_RS20650 Protein ID WP_046051755.1
Coordinates 4444045..4444422 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag YE5303_RS20645 Protein ID WP_167493973.1
Coordinates 4443664..4443993 (+) Length 110 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
YE5303_RS24230 4439260..4439538 + 279 WP_173426638.1 hypothetical protein -
YE5303_RS20605 4439573..4439860 + 288 WP_052705596.1 hypothetical protein -
YE5303_RS20610 4439873..4440184 + 312 WP_046051747.1 hypothetical protein -
YE5303_RS20615 4440224..4440622 + 399 WP_046051748.1 hypothetical protein -
YE5303_RS20620 4440683..4441216 + 534 WP_046051749.1 DUF4234 domain-containing protein -
YE5303_RS20625 4441306..4442124 + 819 WP_046051750.1 DUF945 domain-containing protein -
YE5303_RS20630 4442395..4442874 + 480 WP_046051751.1 antirestriction protein -
YE5303_RS20635 4442886..4443365 + 480 WP_046051752.1 DNA repair protein RadC -
YE5303_RS20640 4443386..4443607 + 222 WP_046051753.1 DUF987 domain-containing protein -
YE5303_RS20645 4443664..4443993 + 330 WP_167493973.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
YE5303_RS20650 4444045..4444422 + 378 WP_046051755.1 TA system toxin CbtA family protein Toxin
YE5303_RS20655 4444419..4444910 + 492 WP_046051756.1 hypothetical protein -
YE5303_RS20660 4444940..4445143 + 204 WP_046051757.1 DUF957 domain-containing protein -
YE5303_RS20665 4445223..4446071 + 849 WP_046051758.1 DUF4942 domain-containing protein -
YE5303_RS20670 4446443..4447426 - 984 WP_046051759.1 site-specific integrase -
YE5303_RS20675 4447445..4448896 - 1452 WP_046051760.1 TraI domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - chuA / chuS 4420942..4521591 100649


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(4-103)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13840.75 Da        Isoelectric Point: 6.7148

>T284953 WP_046051755.1 NZ_HF571988:4444045-4444422 [Yersinia enterocolitica (type O:5) str. YE53/03]
MQTQPLSSTQEASSRPTPVEIWQQLLIYLLERHYGLLLQDTQFGDGNVIQQHIDAGISLADALNFLVEKSELVRIDLPGF
SIQHQSQFISAIDILRARKVTGLMQRTGYKAVTCAISGRSSGGQQ

Download         Length: 378 bp

Antitoxin


Download         Length: 110 a.a.        Molecular weight: 12214.88 Da        Isoelectric Point: 6.3163

>AT284953 WP_167493973.1 NZ_HF571988:4443664-4443993 [Yersinia enterocolitica (type O:5) str. YE53/03]
IAEPWWGLKRSITPCFGARLVQENNRLHYLADRASITGQFSDADLRHLDQAFPLLLKQLELMLTSDELTPRHQHCVTLYA
KGLTCEADSLGSHGYVYVAIYPTPSEATA

Download         Length: 330 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References