Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4205996..4206715 | Replicon | chromosome |
Accession | NZ_HF571988 | ||
Organism | Yersinia enterocolitica (type O:5) str. YE53/03 isolate host faecal sample |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | YE5303_RS19550 | Protein ID | WP_046051652.1 |
Coordinates | 4205996..4206316 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | YE5303_RS19555 | Protein ID | WP_046051653.1 |
Coordinates | 4206350..4206715 (-) | Length | 122 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
YE5303_RS19530 | 4201965..4202900 | + | 936 | Protein_3813 | DNA-protecting protein DprA | - |
YE5303_RS19535 | 4203192..4204304 | - | 1113 | WP_072084067.1 | IS3 family transposase | - |
YE5303_RS19545 | 4205046..4205882 | - | 837 | WP_046051651.1 | DUF4942 domain-containing protein | - |
YE5303_RS19550 | 4205996..4206316 | - | 321 | WP_046051652.1 | TA system toxin CbtA family protein | Toxin |
YE5303_RS19555 | 4206350..4206715 | - | 366 | WP_046051653.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
YE5303_RS23705 | 4206747..4206968 | - | 222 | WP_080342212.1 | DUF987 domain-containing protein | - |
YE5303_RS19560 | 4206977..4207447 | - | 471 | WP_046051654.1 | DNA repair protein RadC | - |
YE5303_RS19565 | 4207518..4208339 | - | 822 | WP_046051655.1 | DUF945 domain-containing protein | - |
YE5303_RS19570 | 4208415..4208855 | - | 441 | WP_046051656.1 | hypothetical protein | - |
YE5303_RS19575 | 4208891..4209070 | - | 180 | WP_046051657.1 | hypothetical protein | - |
YE5303_RS19580 | 4209121..4209924 | - | 804 | WP_046051658.1 | hypothetical protein | - |
YE5303_RS19585 | 4209944..4210378 | - | 435 | WP_046051659.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4203192..4204304 | 1112 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12080.80 Da Isoelectric Point: 5.9538
>T284952 WP_046051652.1 NZ_HF571988:c4206316-4205996 [Yersinia enterocolitica (type O:5) str. YE53/03]
MHISTVPATVPVSPRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDSAIQEHIEAGITLADAVNFLVERYELIRTDRKGF
TWQDQTPFLAAIDILRARRATGLMNI
MHISTVPATVPVSPRLSPVQVWQQLLTYLLEHHYGLTLNDTPFHDDSAIQEHIEAGITLADAVNFLVERYELIRTDRKGF
TWQDQTPFLAAIDILRARRATGLMNI
Download Length: 321 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13578.39 Da Isoelectric Point: 5.5403
>AT284952 WP_046051653.1 NZ_HF571988:c4206715-4206350 [Yersinia enterocolitica (type O:5) str. YE53/03]
MQSTTLSGTSAENASCLQWGLKRNITPCFCARLVQEGNRLYFLADRAGFDGSFSDDEALRLDQVFPLMMKQLERMLTTGE
LDPRCQHCVTLHHNELTCEADTLGSHGYVYIAIYPQSAVTR
MQSTTLSGTSAENASCLQWGLKRNITPCFCARLVQEGNRLYFLADRAGFDGSFSDDEALRLDQVFPLMMKQLERMLTTGE
LDPRCQHCVTLHHNELTCEADTLGSHGYVYIAIYPQSAVTR
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|