Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3582582..3583200 | Replicon | chromosome |
| Accession | NZ_HF571988 | ||
| Organism | Yersinia enterocolitica (type O:5) str. YE53/03 isolate host faecal sample | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | Q66DR5 |
| Locus tag | YE5303_RS16955 | Protein ID | WP_002208622.1 |
| Coordinates | 3582997..3583200 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | Q6TU35 |
| Locus tag | YE5303_RS16950 | Protein ID | WP_005167670.1 |
| Coordinates | 3582582..3582950 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| YE5303_RS16915 | 3578245..3578505 | + | 261 | WP_046051448.1 | type B 50S ribosomal protein L31 | - |
| YE5303_RS16920 | 3578521..3578664 | + | 144 | WP_002208618.1 | type B 50S ribosomal protein L36 | - |
| YE5303_RS16925 | 3578792..3579670 | - | 879 | WP_019082550.1 | metal ABC transporter substrate-binding protein | - |
| YE5303_RS16930 | 3579719..3580576 | - | 858 | WP_005163445.1 | metal ABC transporter permease | - |
| YE5303_RS16935 | 3580573..3581301 | - | 729 | WP_046051449.1 | ABC transporter ATP-binding protein | - |
| YE5303_RS16945 | 3582071..3582424 | + | 354 | WP_046051451.1 | hypothetical protein | - |
| YE5303_RS16950 | 3582582..3582950 | + | 369 | WP_005167670.1 | Hha toxicity modulator TomB | Antitoxin |
| YE5303_RS16955 | 3582997..3583200 | + | 204 | WP_002208622.1 | expression modulating protein YmoA | Toxin |
| YE5303_RS16960 | 3584046..3584351 | + | 306 | WP_046052063.1 | MGMT family protein | - |
| YE5303_RS16965 | 3584403..3584933 | - | 531 | WP_046051452.1 | YbaY family lipoprotein | - |
| YE5303_RS16970 | 3585191..3586054 | + | 864 | WP_046051453.1 | acyl-CoA thioesterase II | - |
| YE5303_RS16975 | 3586274..3587563 | - | 1290 | WP_046052064.1 | ammonium transporter AmtB | - |
| YE5303_RS16980 | 3587603..3587941 | - | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8063.31 Da Isoelectric Point: 6.4573
>T284951 WP_002208622.1 NZ_HF571988:3582997-3583200 [Yersinia enterocolitica (type O:5) str. YE53/03]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14134.86 Da Isoelectric Point: 4.4085
>AT284951 WP_005167670.1 NZ_HF571988:3582582-3582950 [Yersinia enterocolitica (type O:5) str. YE53/03]
MDEYSPKRHDVAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDGGDLSELVEEYL
DDTYTLFSSYGINDPELQRWQKTKERLFRLFSGEYICTLMKT
MDEYSPKRHDVAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDGGDLSELVEEYL
DDTYTLFSSYGINDPELQRWQKTKERLFRLFSGEYICTLMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|