Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 930587..931248 | Replicon | chromosome |
| Accession | NZ_HF571988 | ||
| Organism | Yersinia enterocolitica (type O:5) str. YE53/03 isolate host faecal sample | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | S3IMJ6 |
| Locus tag | YE5303_RS04380 | Protein ID | WP_000698542.1 |
| Coordinates | 930925..931248 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | S3J179 |
| Locus tag | YE5303_RS04375 | Protein ID | WP_000065326.1 |
| Coordinates | 930587..930904 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| YE5303_RS04335 | 925727..926551 | + | 825 | WP_000197385.1 | DUF945 domain-containing protein | - |
| YE5303_RS04340 | 926760..927470 | + | 711 | WP_024198336.1 | hypothetical protein | - |
| YE5303_RS04345 | 927496..928032 | + | 537 | WP_000219797.1 | DUF4339 domain-containing protein | - |
| YE5303_RS04350 | 928074..928511 | + | 438 | WP_024198335.1 | hypothetical protein | - |
| YE5303_RS04355 | 928578..928988 | + | 411 | WP_000912997.1 | hypothetical protein | - |
| YE5303_RS04360 | 929066..929302 | + | 237 | WP_000004273.1 | DUF905 domain-containing protein | - |
| YE5303_RS04365 | 929388..929846 | + | 459 | WP_016538084.1 | antirestriction protein | - |
| YE5303_RS04370 | 929862..930338 | + | 477 | WP_000811694.1 | RadC family protein | - |
| YE5303_RS23245 | 930347..930568 | + | 222 | WP_000691995.1 | DUF987 domain-containing protein | - |
| YE5303_RS04375 | 930587..930904 | + | 318 | WP_000065326.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| YE5303_RS04380 | 930925..931248 | + | 324 | WP_000698542.1 | TA system toxin CbtA family protein | Toxin |
| YE5303_RS04385 | 931739..932824 | + | 1086 | WP_046050306.1 | Fic family protein | - |
| YE5303_RS04390 | 933025..933327 | + | 303 | WP_071843353.1 | hypothetical protein | - |
| YE5303_RS04395 | 933481..933996 | - | 516 | WP_019078974.1 | ClbS/DfsB family four-helix bundle protein | - |
| YE5303_RS04400 | 934268..934618 | + | 351 | WP_046050307.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| YE5303_RS04405 | 934852..936141 | + | 1290 | WP_046050308.1 | arsenic transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12350.38 Da Isoelectric Point: 8.9789
>T284943 WP_000698542.1 NZ_HF571988:930925-931248 [Yersinia enterocolitica (type O:5) str. YE53/03]
MKILPATISRAAKPCLPPVAVWQLLLTRLLEKHYGLTLNDTPFSDETVIKEHFDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTNIDIMRARRDLGLLNRN
MKILPATISRAAKPCLPPVAVWQLLLTRLLEKHYGLTLNDTPFSDETVIKEHFDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTNIDIMRARRDLGLLNRN
Download Length: 324 bp
Antitoxin
Download Length: 106 a.a. Molecular weight: 11830.50 Da Isoelectric Point: 6.9367
>AT284943 WP_000065326.1 NZ_HF571988:930587-930904 [Yersinia enterocolitica (type O:5) str. YE53/03]
MSNIIWGLQRDITPRLGTRLVQEGNQLHYLADRACITGKFSDAECLKLDVAFPHFISRMESMLSTGEMNPRHAHCVTLYH
NGFTCEADTLGSCGYVYVAVYSTQR
MSNIIWGLQRDITPRLGTRLVQEGNQLHYLADRACITGKFSDAECLKLDVAFPHFISRMESMLSTGEMNPRHAHCVTLYH
NGFTCEADTLGSCGYVYVAVYSTQR
Download Length: 318 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|