284943

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 930587..931248 Replicon chromosome
Accession NZ_HF571988
Organism Yersinia enterocolitica (type O:5) str. YE53/03 isolate host faecal sample

Toxin (Protein)


Gene name ypjF Uniprot ID S3IMJ6
Locus tag YE5303_RS04380 Protein ID WP_000698542.1
Coordinates 930925..931248 (+) Length 108 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID S3J179
Locus tag YE5303_RS04375 Protein ID WP_000065326.1
Coordinates 930587..930904 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
YE5303_RS04335 925727..926551 + 825 WP_000197385.1 DUF945 domain-containing protein -
YE5303_RS04340 926760..927470 + 711 WP_024198336.1 hypothetical protein -
YE5303_RS04345 927496..928032 + 537 WP_000219797.1 DUF4339 domain-containing protein -
YE5303_RS04350 928074..928511 + 438 WP_024198335.1 hypothetical protein -
YE5303_RS04355 928578..928988 + 411 WP_000912997.1 hypothetical protein -
YE5303_RS04360 929066..929302 + 237 WP_000004273.1 DUF905 domain-containing protein -
YE5303_RS04365 929388..929846 + 459 WP_016538084.1 antirestriction protein -
YE5303_RS04370 929862..930338 + 477 WP_000811694.1 RadC family protein -
YE5303_RS23245 930347..930568 + 222 WP_000691995.1 DUF987 domain-containing protein -
YE5303_RS04375 930587..930904 + 318 WP_000065326.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
YE5303_RS04380 930925..931248 + 324 WP_000698542.1 TA system toxin CbtA family protein Toxin
YE5303_RS04385 931739..932824 + 1086 WP_046050306.1 Fic family protein -
YE5303_RS04390 933025..933327 + 303 WP_071843353.1 hypothetical protein -
YE5303_RS04395 933481..933996 - 516 WP_019078974.1 ClbS/DfsB family four-helix bundle protein -
YE5303_RS04400 934268..934618 + 351 WP_046050307.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
YE5303_RS04405 934852..936141 + 1290 WP_046050308.1 arsenic transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-107)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 12350.38 Da        Isoelectric Point: 8.9789

>T284943 WP_000698542.1 NZ_HF571988:930925-931248 [Yersinia enterocolitica (type O:5) str. YE53/03]
MKILPATISRAAKPCLPPVAVWQLLLTRLLEKHYGLTLNDTPFSDETVIKEHFDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTNIDIMRARRDLGLLNRN

Download         Length: 324 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11830.50 Da        Isoelectric Point: 6.9367

>AT284943 WP_000065326.1 NZ_HF571988:930587-930904 [Yersinia enterocolitica (type O:5) str. YE53/03]
MSNIIWGLQRDITPRLGTRLVQEGNQLHYLADRACITGKFSDAECLKLDVAFPHFISRMESMLSTGEMNPRHAHCVTLYH
NGFTCEADTLGSCGYVYVAVYSTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S3IMJ6

Antitoxin

Source ID Structure
AlphaFold DB S3J179

References