Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 885562..886234 | Replicon | chromosome |
Accession | NZ_HF571988 | ||
Organism | Yersinia enterocolitica (type O:5) str. YE53/03 isolate host faecal sample |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | YE5303_RS04135 | Protein ID | WP_046050300.1 |
Coordinates | 885809..886234 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A7U7FJE4 |
Locus tag | YE5303_RS04130 | Protein ID | WP_004390965.1 |
Coordinates | 885562..885828 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
YE5303_RS04105 | 881533..881970 | + | 438 | WP_019082405.1 | lipocalin-like domain-containing protein | - |
YE5303_RS04110 | 881986..882735 | + | 750 | WP_019082406.1 | SDR family oxidoreductase | - |
YE5303_RS04115 | 882748..883350 | - | 603 | WP_011817027.1 | HD domain-containing protein | - |
YE5303_RS04120 | 883588..884271 | + | 684 | WP_019082407.1 | hemolysin III family protein | - |
YE5303_RS04125 | 884304..885296 | - | 993 | WP_046050299.1 | tRNA-modifying protein YgfZ | - |
YE5303_RS04130 | 885562..885828 | + | 267 | WP_004390965.1 | FAD assembly factor SdhE | Antitoxin |
YE5303_RS04135 | 885809..886234 | + | 426 | WP_046050300.1 | protein YgfX | Toxin |
YE5303_RS04140 | 886234..886932 | + | 699 | WP_011817024.1 | two-component system response regulator CreB | - |
YE5303_RS04145 | 886943..888370 | + | 1428 | WP_019078986.1 | two-component system sensor histidine kinase CreC | - |
YE5303_RS04150 | 888462..889883 | + | 1422 | WP_046050301.1 | cell envelope integrity protein CreD | - |
YE5303_RS04155 | 889955..890473 | - | 519 | WP_019078984.1 | flavodoxin FldB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 16452.24 Da Isoelectric Point: 9.8217
>T284942 WP_046050300.1 NZ_HF571988:885809-886234 [Yersinia enterocolitica (type O:5) str. YE53/03]
VAQWRCDLRISWHTQLFSLLAHGVLVTLTLVAPWPQGYTALWLVLLTLVVFECIRSQKNITSCQGEIRLKPGNIVLWKRH
EWVVIKQPWITRYGVLLSLQQTSNRSTRKRLWLAADSMSEEEWRQLCLLLRHSFGSDEGIN
VAQWRCDLRISWHTQLFSLLAHGVLVTLTLVAPWPQGYTALWLVLLTLVVFECIRSQKNITSCQGEIRLKPGNIVLWKRH
EWVVIKQPWITRYGVLLSLQQTSNRSTRKRLWLAADSMSEEEWRQLCLLLRHSFGSDEGIN
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|