Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1886040..1886669 | Replicon | chromosome |
| Accession | NZ_HF545616 | ||
| Organism | Ruminococcus bicirculans strain 80/3 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | W0U7D1 |
| Locus tag | RBI_RS08720 | Protein ID | WP_038672383.1 |
| Coordinates | 1886040..1886222 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | W0U6I9 |
| Locus tag | RBI_RS08725 | Protein ID | WP_038672386.1 |
| Coordinates | 1886259..1886669 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RBI_RS08705 | 1881422..1883926 | + | 2505 | WP_038672377.1 | type IV secretory system conjugative DNA transfer family protein | - |
| RBI_RS08710 | 1883913..1884659 | + | 747 | WP_038672379.1 | helix-turn-helix domain-containing protein | - |
| RBI_RS08715 | 1884876..1885958 | + | 1083 | WP_038672381.1 | site-specific integrase | - |
| RBI_RS08720 | 1886040..1886222 | + | 183 | WP_038672383.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| RBI_RS08725 | 1886259..1886669 | + | 411 | WP_038672386.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| RBI_RS08730 | 1886716..1886988 | + | 273 | WP_038672388.1 | helix-turn-helix domain-containing protein | - |
| RBI_RS08740 | 1888224..1890398 | + | 2175 | WP_022287606.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| RBI_RS08745 | 1890654..1891172 | + | 519 | WP_038672390.1 | anaerobic ribonucleoside-triphosphate reductase activating protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1842415..1887850 | 45435 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6758.83 Da Isoelectric Point: 10.4719
>T284941 WP_038672383.1 NZ_HF545616:1886040-1886222 [Ruminococcus bicirculans]
MTFKEMDRLLKEAGWYYDGARGSHFKYKHKSQNGIVIVPNHKGDIPKGTANAILKQAGLK
MTFKEMDRLLKEAGWYYDGARGSHFKYKHKSQNGIVIVPNHKGDIPKGTANAILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15165.36 Da Isoelectric Point: 4.2253
>AT284941 WP_038672386.1 NZ_HF545616:1886259-1886669 [Ruminococcus bicirculans]
MLSMYPACFYKEKEGGYSVIFPVLGIATCGDDINQAMSMAVDCLAGYLYELKLSKEEVPAAPDMDKIDIDAEYNDYESAF
VNMVTVDVDEYAKKHFEKSVKKTLTIPSWLNELAVANGINFSQVLQTALKDKLNVN
MLSMYPACFYKEKEGGYSVIFPVLGIATCGDDINQAMSMAVDCLAGYLYELKLSKEEVPAAPDMDKIDIDAEYNDYESAF
VNMVTVDVDEYAKKHFEKSVKKTLTIPSWLNELAVANGINFSQVLQTALKDKLNVN
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|