Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 5005906..5006716 | Replicon | chromosome |
Accession | NZ_FO834906 | ||
Organism | Klebsiella pneumoniae strain Kp52.145 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | W9BJB1 |
Locus tag | BN49_RS25770 | Protein ID | WP_016529513.1 |
Coordinates | 5005906..5006439 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | BN49_RS25775 | Protein ID | WP_002887278.1 |
Coordinates | 5006450..5006716 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN49_RS25765 | 5004737..5005858 | + | 1122 | WP_009309849.1 | cupin domain-containing protein | - |
BN49_RS25770 | 5005906..5006439 | - | 534 | WP_016529513.1 | GNAT family N-acetyltransferase | Toxin |
BN49_RS25775 | 5006450..5006716 | - | 267 | WP_002887278.1 | DUF1778 domain-containing protein | Antitoxin |
BN49_RS25780 | 5006819..5008252 | - | 1434 | WP_046043909.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
BN49_RS25785 | 5008242..5008925 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
BN49_RS25795 | 5009097..5010482 | + | 1386 | WP_016530864.1 | efflux transporter outer membrane subunit | - |
BN49_RS25800 | 5010500..5010844 | + | 345 | WP_004192220.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19776.63 Da Isoelectric Point: 5.2614
>T284937 WP_016529513.1 NZ_FO834906:c5006439-5005906 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGLDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGLDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W9BJB1 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |