Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4976664..4977289 | Replicon | chromosome |
Accession | NZ_FO834906 | ||
Organism | Klebsiella pneumoniae strain Kp52.145 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | BN49_RS25635 | Protein ID | WP_002882817.1 |
Coordinates | 4976664..4977047 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | BN49_RS25640 | Protein ID | WP_004150355.1 |
Coordinates | 4977047..4977289 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN49_RS25620 | 4974030..4974932 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
BN49_RS25625 | 4974929..4975564 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
BN49_RS25630 | 4975561..4976490 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
BN49_RS25635 | 4976664..4977047 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
BN49_RS25640 | 4977047..4977289 | - | 243 | WP_004150355.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
BN49_RS25645 | 4977491..4978408 | + | 918 | WP_004178029.1 | alpha/beta hydrolase | - |
BN49_RS25650 | 4978422..4979363 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
BN49_RS25655 | 4979408..4979845 | - | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
BN49_RS25660 | 4979842..4980702 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
BN49_RS25665 | 4980696..4981295 | - | 600 | WP_046043904.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T284936 WP_002882817.1 NZ_FO834906:c4977047-4976664 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |