Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1457780..1458399 | Replicon | chromosome |
| Accession | NZ_FO834906 | ||
| Organism | Klebsiella pneumoniae strain Kp52.145 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | BN49_RS08490 | Protein ID | WP_002892050.1 |
| Coordinates | 1457780..1457998 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | BN49_RS08495 | Protein ID | WP_002892066.1 |
| Coordinates | 1458025..1458399 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN49_RS08455 | 1453827..1454090 | + | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
| BN49_RS08460 | 1454090..1454230 | + | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| BN49_RS08465 | 1454227..1454925 | - | 699 | WP_002892021.1 | GNAT family N-acetyltransferase | - |
| BN49_RS08470 | 1455026..1456477 | + | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| BN49_RS08475 | 1456452..1456922 | - | 471 | WP_002892026.1 | YlaC family protein | - |
| BN49_RS30910 | 1456943..1457083 | + | 141 | WP_004147370.1 | hypothetical protein | - |
| BN49_RS08485 | 1457055..1457621 | - | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| BN49_RS08490 | 1457780..1457998 | - | 219 | WP_002892050.1 | hemolysin expression modulator Hha | Toxin |
| BN49_RS08495 | 1458025..1458399 | - | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| BN49_RS08500 | 1458885..1462031 | - | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| BN49_RS08505 | 1462054..1463247 | - | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T284930 WP_002892050.1 NZ_FO834906:c1457998-1457780 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT284930 WP_002892066.1 NZ_FO834906:c1458399-1458025 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |