Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 109386..110137 | Replicon | plasmid II |
| Accession | NZ_FO834905 | ||
| Organism | Klebsiella pneumoniae strain Kp52.145 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | W9BA31 |
| Locus tag | BN49_RS01090 | Protein ID | WP_032104592.1 |
| Coordinates | 109386..109868 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | W9B1S8 |
| Locus tag | BN49_RS01095 | Protein ID | WP_016529519.1 |
| Coordinates | 109859..110137 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BN49_RS28480 | 105483..105935 | + | 453 | WP_071829949.1 | transcriptional repressor | - |
| BN49_RS01070 | 106083..107315 | + | 1233 | Protein_112 | IS3 family transposase | - |
| BN49_RS01075 | 107700..107936 | + | 237 | WP_016529523.1 | hypothetical protein | - |
| BN49_RS01080 | 108002..108607 | - | 606 | Protein_114 | GIY-YIG nuclease family protein | - |
| BN49_RS01085 | 108944..109348 | - | 405 | WP_016529521.1 | DUF2251 domain-containing protein | - |
| BN49_RS01090 | 109386..109868 | - | 483 | WP_032104592.1 | GNAT family N-acetyltransferase | Toxin |
| BN49_RS01095 | 109859..110137 | - | 279 | WP_016529519.1 | DUF1778 domain-containing protein | Antitoxin |
| BN49_RS01100 | 110445..110981 | + | 537 | WP_032445791.1 | hypothetical protein | - |
| BN49_RS01105 | 111365..112375 | - | 1011 | WP_004152284.1 | zinc-binding alcohol dehydrogenase family protein | - |
| BN49_RS01115 | 112836..113918 | + | 1083 | WP_016528990.1 | DNA-binding transcriptional repressor LacI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA / iroN / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA | 1..121703 | 121703 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17781.73 Da Isoelectric Point: 9.4946
>T284923 WP_032104592.1 NZ_FO834905:c109868-109386 [Klebsiella pneumoniae]
MGMRPPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
MGMRPPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|