Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 37564..38474 Replicon plasmid II
Accession NZ_FO834905
Organism Klebsiella pneumoniae strain Kp52.145

Toxin (Protein)


Gene name - Uniprot ID W9B9V2
Locus tag BN49_RS00725 Protein ID WP_016528981.1
Coordinates 37564..38034 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID W9B1L8
Locus tag BN49_RS00730 Protein ID WP_016528982.1
Coordinates 38031..38474 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BN49_RS30120 32680..32874 - 195 Protein_32 IS66 family transposase -
BN49_RS00705 33359..33517 + 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
BN49_RS30785 34158..34325 - 168 WP_004117900.1 hypothetical protein -
BN49_RS30790 34715..35548 + 834 Protein_35 Hok/Gef family protein -
BN49_RS28335 35561..36793 - 1233 Protein_36 IS3 family transposase -
BN49_RS00720 37193..37453 + 261 WP_016528980.1 hypothetical protein -
BN49_RS00725 37564..38034 - 471 WP_016528981.1 RES family NAD+ phosphorylase Toxin
BN49_RS00730 38031..38474 - 444 WP_016528982.1 DUF2384 domain-containing protein Antitoxin
BN49_RS30135 38575..39064 - 490 Protein_40 DUF4113 domain-containing protein -
BN49_RS28345 39173..39394 - 222 WP_016528984.1 DUF2188 domain-containing protein -
BN49_RS00740 39539..39694 - 156 WP_016528985.1 hypothetical protein -
BN49_RS00745 39769..41895 - 2127 WP_032105434.1 TonB-dependent receptor family protein -
BN49_RS00750 41982..42935 - 954 Protein_44 fec operon regulator FecR -
BN49_RS00755 42932..43453 - 522 WP_004213635.1 sigma-70 family RNA polymerase sigma factor -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iroN / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA 1..121703 121703
- flank IS/Tn - - 35561..36466 905


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre/MbcA/ParS-like, toxin-binding domain

(94-144)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17603.85 Da        Isoelectric Point: 4.4093

>T284922 WP_016528981.1 NZ_FO834905:c38034-37564 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTWSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16494.83 Da        Isoelectric Point: 10.2498

>AT284922 WP_016528982.1 NZ_FO834905:c38474-38031 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEIIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W9B9V2

Antitoxin

Source ID Structure
AlphaFold DB W9B1L8

References