Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 85561..86096 | Replicon | plasmid I |
Accession | NZ_FO834904 | ||
Organism | Klebsiella pneumoniae strain Kp52.145 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | BN49_RS00500 | Protein ID | WP_016531292.1 |
Coordinates | 85561..85848 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | W9BAK2 |
Locus tag | BN49_RS00505 | Protein ID | WP_016531291.1 |
Coordinates | 85845..86096 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN49_RS00475 | 81360..82580 | - | 1221 | WP_032446666.1 | ISL3 family transposase | - |
BN49_RS00480 | 82741..83217 | + | 477 | WP_016529487.1 | hypothetical protein | - |
BN49_RS00485 | 83474..83761 | - | 288 | WP_016529486.1 | hypothetical protein | - |
BN49_RS00490 | 83851..84513 | - | 663 | WP_016529485.1 | chromosome partitioning protein ParA | - |
BN49_RS00500 | 85561..85848 | - | 288 | WP_016531292.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BN49_RS00505 | 85845..86096 | - | 252 | WP_016531291.1 | toxin-antitoxin stability system antitoxin protein StbD | Antitoxin |
BN49_RS00510 | 86192..87463 | - | 1272 | WP_046041953.1 | Y-family DNA polymerase | - |
BN49_RS00515 | 87463..87957 | - | 495 | WP_109234271.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
BN49_RS00520 | 87943..89022 | + | 1080 | WP_016531016.1 | IS481 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | clbI / basG | 1..95087 | 95087 | |
- | flank | IS/Tn | - | - | 81360..82580 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11120.16 Da Isoelectric Point: 10.4373
>T284921 WP_016531292.1 NZ_FO834904:c85848-85561 [Klebsiella pneumoniae]
MTYTVKFREDALKEWNKLDKTIQQQFAKKLKKCCENPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDNQLIIAIVAVGK
RERSDVYTLASERMK
MTYTVKFREDALKEWNKLDKTIQQQFAKKLKKCCENPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDNQLIIAIVAVGK
RERSDVYTLASERMK
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|