Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4142835..4143471 | Replicon | chromosome |
Accession | NZ_FO818637 | ||
Organism | Xenorhabdus bovienii strain CS03 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A0B6XDE4 |
Locus tag | XBW1_RS18940 | Protein ID | WP_046337596.1 |
Coordinates | 4142835..4143239 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | XBW1_RS18945 | Protein ID | WP_196244143.1 |
Coordinates | 4143232..4143471 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XBW1_RS18920 | 4138962..4139702 | + | 741 | WP_046337592.1 | SDR family oxidoreductase | - |
XBW1_RS18925 | 4139865..4139975 | - | 111 | Protein_3773 | PTS sugar transporter subunit IIB | - |
XBW1_RS18930 | 4140279..4141661 | - | 1383 | WP_046337593.1 | IS4 family transposase | - |
XBW1_RS18935 | 4141935..4142630 | + | 696 | WP_046337595.1 | IS6 family transposase | - |
XBW1_RS18940 | 4142835..4143239 | - | 405 | WP_046337596.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
XBW1_RS18945 | 4143232..4143471 | - | 240 | WP_196244143.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
XBW1_RS24870 | 4143547..4143837 | - | 291 | WP_155399172.1 | hypothetical protein | - |
XBW1_RS18955 | 4144626..4145012 | + | 387 | WP_046337598.1 | VOC family protein | - |
XBW1_RS18960 | 4145077..4147821 | + | 2745 | WP_046337599.1 | CRISPR-associated helicase/endonuclease Cas3 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4136395..4145012 | 8617 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15217.58 Da Isoelectric Point: 9.7971
>T284915 WP_046337596.1 NZ_FO818637:c4143239-4142835 [Xenorhabdus bovienii]
MIKYLLDTNIVIFTIKRKPESLLPKFNQHTNQLAISAITLAELIFGAEKSMNPTKNLATVNDFVSRLTVLPYDEQAAFHY
GDIRAILEKKGKRIGDNDLHIAAHARSKGLIVVTNNTREFERVDGLRIEDWTKP
MIKYLLDTNIVIFTIKRKPESLLPKFNQHTNQLAISAITLAELIFGAEKSMNPTKNLATVNDFVSRLTVLPYDEQAAFHY
GDIRAILEKKGKRIGDNDLHIAAHARSKGLIVVTNNTREFERVDGLRIEDWTKP
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|