Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mosAT/AbiEii-AbiEi |
Location | 3912716..3914399 | Replicon | chromosome |
Accession | NZ_FO818637 | ||
Organism | Xenorhabdus bovienii strain CS03 |
Toxin (Protein)
Gene name | mosT | Uniprot ID | A0A0B6XC08 |
Locus tag | XBW1_RS17905 | Protein ID | WP_046337508.1 |
Coordinates | 3912716..3913633 (-) | Length | 306 a.a. |
Antitoxin (Protein)
Gene name | mosA | Uniprot ID | A0A077N7D9 |
Locus tag | XBW1_RS17910 | Protein ID | WP_038202374.1 |
Coordinates | 3913626..3914399 (-) | Length | 258 a.a. |
Genomic Context
Location: 3910770..3911375 (606 bp)
Type: Others
Protein ID: WP_046337506.1
Type: Others
Protein ID: WP_046337506.1
Location: 3911562..3912599 (1038 bp)
Type: Others
Protein ID: WP_046337507.1
Type: Others
Protein ID: WP_046337507.1
Location: 3915615..3915827 (213 bp)
Type: Others
Protein ID: WP_012989909.1
Type: Others
Protein ID: WP_012989909.1
Location: 3916718..3916987 (270 bp)
Type: Others
Protein ID: WP_046337510.1
Type: Others
Protein ID: WP_046337510.1
Location: 3916966..3917139 (174 bp)
Type: Others
Protein ID: WP_082243360.1
Type: Others
Protein ID: WP_082243360.1
Location: 3917192..3918033 (842 bp)
Type: Others
Protein ID: WP_155399205.1
Type: Others
Protein ID: WP_155399205.1
Location: 3918058..3918330 (273 bp)
Type: Others
Protein ID: Protein_3593
Type: Others
Protein ID: Protein_3593
Location: 3918355..3918825 (471 bp)
Type: Others
Protein ID: WP_046337511.1
Type: Others
Protein ID: WP_046337511.1
Location: 3919001..3919387 (387 bp)
Type: Others
Protein ID: WP_051875985.1
Type: Others
Protein ID: WP_051875985.1
Location: 3908708..3910276 (1569 bp)
Type: Others
Protein ID: WP_046337505.1
Type: Others
Protein ID: WP_046337505.1
Location: 3912716..3913633 (918 bp)
Type: Toxin
Protein ID: WP_046337508.1
Type: Toxin
Protein ID: WP_046337508.1
Location: 3913626..3914399 (774 bp)
Type: Antitoxin
Protein ID: WP_038202374.1
Type: Antitoxin
Protein ID: WP_038202374.1
Location: 3914727..3915155 (429 bp)
Type: Others
Protein ID: WP_038216214.1
Type: Others
Protein ID: WP_038216214.1
Location: 3916146..3916331 (186 bp)
Type: Others
Protein ID: Protein_3589
Type: Others
Protein ID: Protein_3589
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XBW1_RS17890 | 3908708..3910276 | - | 1569 | WP_046337505.1 | phosphoethanolamine transferase | - |
XBW1_RS17895 | 3910770..3911375 | + | 606 | WP_046337506.1 | plasmid pRiA4b ORF-3 family protein | - |
XBW1_RS17900 | 3911562..3912599 | + | 1038 | WP_046337507.1 | IS630 family transposase | - |
XBW1_RS17905 | 3912716..3913633 | - | 918 | WP_046337508.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | Toxin |
XBW1_RS17910 | 3913626..3914399 | - | 774 | WP_038202374.1 | type IV toxin-antitoxin system AbiEi family antitoxin | Antitoxin |
XBW1_RS17915 | 3914727..3915155 | - | 429 | WP_038216214.1 | IS200/IS605 family transposase | - |
XBW1_RS17920 | 3915615..3915827 | + | 213 | WP_012989909.1 | RNA chaperone/antiterminator CspA | - |
XBW1_RS17925 | 3916146..3916331 | - | 186 | Protein_3589 | Fic family protein | - |
XBW1_RS17935 | 3916718..3916987 | + | 270 | WP_046337510.1 | transposase | - |
XBW1_RS24175 | 3916966..3917139 | + | 174 | WP_082243360.1 | hypothetical protein | - |
XBW1_RS24180 | 3917192..3918033 | + | 842 | WP_155399205.1 | IS5 family transposase | - |
XBW1_RS24860 | 3918058..3918330 | + | 273 | Protein_3593 | IS1 family transposase | - |
XBW1_RS17950 | 3918355..3918825 | + | 471 | WP_046337511.1 | SCP2 sterol-binding domain-containing protein | - |
XBW1_RS17955 | 3919001..3919387 | + | 387 | WP_051875985.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3910770..3924602 | 13832 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 306 a.a. Molecular weight: 34600.68 Da Isoelectric Point: 4.8558
>T284914 WP_046337508.1 NZ_FO818637:c3913633-3912716 [Xenorhabdus bovienii]
MDKYSPYYRQVALLISALLVVASERCFALKGGTAINLFVRDFPRLSVDIDLVYVPLESRDVALANVRAALTRITGLLQQQ
VGVSAILQTNNHDEMRIIVSSQEAQIKIEVSPVARGTLYPSQDLDVAEAVEDEFGFATIQVVSMADLYGGKLCAALDRQH
PRDLYDVKMLLETQGIDRHIFNGFITYLLSHPRPLSEVLNPRWKDISELYAHEFSGMTFDNVSLEELNVVPEFMISALKS
QFTQQDFDFLISFKSGEPDWQLVPESQIQHLPAVKWKLHNIGRIPEEKHIQALEKLERVLNDWMG
MDKYSPYYRQVALLISALLVVASERCFALKGGTAINLFVRDFPRLSVDIDLVYVPLESRDVALANVRAALTRITGLLQQQ
VGVSAILQTNNHDEMRIIVSSQEAQIKIEVSPVARGTLYPSQDLDVAEAVEDEFGFATIQVVSMADLYGGKLCAALDRQH
PRDLYDVKMLLETQGIDRHIFNGFITYLLSHPRPLSEVLNPRWKDISELYAHEFSGMTFDNVSLEELNVVPEFMISALKS
QFTQQDFDFLISFKSGEPDWQLVPESQIQHLPAVKWKLHNIGRIPEEKHIQALEKLERVLNDWMG
Download Length: 918 bp
Antitoxin
Download Length: 258 a.a. Molecular weight: 29293.73 Da Isoelectric Point: 9.8753
>AT284914 WP_038202374.1 NZ_FO818637:c3914399-3913626 [Xenorhabdus bovienii]
MSSKLNWLLQNTAPGSLVLQSWLTKHGISPSLANKYMHSNWLQKLRTGVYVRAGRDPEWWDVVLCLQNQLGFPVHLAGLT
SLGYQGRSHYLQFKQQAIWLYVQDKAALPKWFKEFPNIEWLLLSNQKLAKHDEKYLTEVEIKGEQLRTSVPELAAYEIAN
AVPGILSFEHAAELFQGLVNLSPRKVEALLQSSRAVQTNRLYLFLADYYAHAWAKRLDQTNIDLGAGKRQIVSGGKLDRK
YQITVPEKFVSHGLLHG
MSSKLNWLLQNTAPGSLVLQSWLTKHGISPSLANKYMHSNWLQKLRTGVYVRAGRDPEWWDVVLCLQNQLGFPVHLAGLT
SLGYQGRSHYLQFKQQAIWLYVQDKAALPKWFKEFPNIEWLLLSNQKLAKHDEKYLTEVEIKGEQLRTSVPELAAYEIAN
AVPGILSFEHAAELFQGLVNLSPRKVEALLQSSRAVQTNRLYLFLADYYAHAWAKRLDQTNIDLGAGKRQIVSGGKLDRK
YQITVPEKFVSHGLLHG
Download Length: 774 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B6XC08 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A077N7D9 |