Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-higA/HigB-HigA |
| Location | 3828645..3829496 | Replicon | chromosome |
| Accession | NZ_FO818637 | ||
| Organism | Xenorhabdus bovienii strain CS03 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | XBW1_RS17515 | Protein ID | WP_082243358.1 |
| Coordinates | 3828645..3829022 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | XBW1_RS17520 | Protein ID | WP_038204870.1 |
| Coordinates | 3829026..3829496 (+) | Length | 157 a.a. |
Genomic Context
Location: 3823718..3824623 (906 bp)
Type: Others
Protein ID: WP_046337466.1
Type: Others
Protein ID: WP_046337466.1
Location: 3824724..3825182 (459 bp)
Type: Others
Protein ID: WP_046337467.1
Type: Others
Protein ID: WP_046337467.1
Location: 3827438..3828178 (741 bp)
Type: Others
Protein ID: WP_046337468.1
Type: Others
Protein ID: WP_046337468.1
Location: 3828645..3829022 (378 bp)
Type: Toxin
Protein ID: WP_082243358.1
Type: Toxin
Protein ID: WP_082243358.1
Location: 3829026..3829496 (471 bp)
Type: Antitoxin
Protein ID: WP_038204870.1
Type: Antitoxin
Protein ID: WP_038204870.1
Location: 3831680..3832600 (921 bp)
Type: Others
Protein ID: WP_046337470.1
Type: Others
Protein ID: WP_046337470.1
Location: 3825376..3826068 (693 bp)
Type: Others
Protein ID: WP_038222751.1
Type: Others
Protein ID: WP_038222751.1
Location: 3826209..3827225 (1017 bp)
Type: Others
Protein ID: WP_012989845.1
Type: Others
Protein ID: WP_012989845.1
Location: 3829544..3830095 (552 bp)
Type: Others
Protein ID: WP_038204872.1
Type: Others
Protein ID: WP_038204872.1
Location: 3830092..3831390 (1299 bp)
Type: Others
Protein ID: WP_046337469.1
Type: Others
Protein ID: WP_046337469.1
Location: 3832663..3833442 (780 bp)
Type: Others
Protein ID: WP_038197005.1
Type: Others
Protein ID: WP_038197005.1
Location: 3833498..3833983 (486 bp)
Type: Others
Protein ID: WP_038213357.1
Type: Others
Protein ID: WP_038213357.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| XBW1_RS17490 | 3823718..3824623 | + | 906 | WP_046337466.1 | hypothetical protein | - |
| XBW1_RS17495 | 3824724..3825182 | + | 459 | WP_046337467.1 | hypothetical protein | - |
| XBW1_RS17500 | 3825376..3826068 | - | 693 | WP_038222751.1 | O-methyltransferase | - |
| XBW1_RS17505 | 3826209..3827225 | - | 1017 | WP_012989845.1 | UDP-glucose 4-epimerase GalE | - |
| XBW1_RS17510 | 3827438..3828178 | + | 741 | WP_046337468.1 | 4'-phosphopantetheinyl transferase superfamily protein | - |
| XBW1_RS17515 | 3828645..3829022 | + | 378 | WP_082243358.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| XBW1_RS17520 | 3829026..3829496 | + | 471 | WP_038204870.1 | transcriptional regulator | Antitoxin |
| XBW1_RS17525 | 3829544..3830095 | - | 552 | WP_038204872.1 | 3-isopropylmalate dehydratase | - |
| XBW1_RS17530 | 3830092..3831390 | - | 1299 | WP_046337469.1 | 3-isopropylmalate dehydratase large subunit | - |
| XBW1_RS17535 | 3831680..3832600 | + | 921 | WP_046337470.1 | LysR family transcriptional regulator | - |
| XBW1_RS17540 | 3832663..3833442 | - | 780 | WP_038197005.1 | Sua5/YciO/YrdC/YwlC family protein | - |
| XBW1_RS17545 | 3833498..3833983 | - | 486 | WP_038213357.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 15035.55 Da Isoelectric Point: 10.6216
>T284913 WP_082243358.1 NZ_FO818637:3828645-3829022 [Xenorhabdus bovienii]
MRVRVITARVIIEVMRKHAQWKVGLKLWLDVFDKAALRFESYAQIRDLWLQTSAWNVDRIPHELLEAGNQKGPLDIYIFD
IHKNKCRIIAWLNPKSGTFYIKDVCSHAKYDRWWREQTKSNRPKR
MRVRVITARVIIEVMRKHAQWKVGLKLWLDVFDKAALRFESYAQIRDLWLQTSAWNVDRIPHELLEAGNQKGPLDIYIFD
IHKNKCRIIAWLNPKSGTFYIKDVCSHAKYDRWWREQTKSNRPKR
Download Length: 378 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17848.57 Da Isoelectric Point: 4.7275
>AT284913 WP_038204870.1 NZ_FO818637:3829026-3829496 [Xenorhabdus bovienii]
MRQALLVYEEIDGIIKKLPQMMQSVSDQLSPLALLFSACLEPVENEEDLKARMVIIDELYSYADDTEHVAAKFADFVTDR
IYEYETKNRNVSNVSPREALAFFMKERRIRQADLCDIATQSVISEILHGKRSMTIQQVKGFAKFFGVPVETFMGTL
MRQALLVYEEIDGIIKKLPQMMQSVSDQLSPLALLFSACLEPVENEEDLKARMVIIDELYSYADDTEHVAAKFADFVTDR
IYEYETKNRNVSNVSPREALAFFMKERRIRQADLCDIATQSVISEILHGKRSMTIQQVKGFAKFFGVPVETFMGTL
Download Length: 471 bp