Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 879580..880199 | Replicon | chromosome |
| Accession | NZ_FO818637 | ||
| Organism | Xenorhabdus bovienii strain CS03 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | N1NUC1 |
| Locus tag | XBW1_RS04185 | Protein ID | WP_010845060.1 |
| Coordinates | 879996..880199 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A077MYD9 |
| Locus tag | XBW1_RS04180 | Protein ID | WP_038191932.1 |
| Coordinates | 879580..879948 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| XBW1_RS04170 | 874614..875813 | + | 1200 | WP_038191927.1 | efflux RND transporter periplasmic adaptor subunit | - |
| XBW1_RS04175 | 875829..878978 | + | 3150 | WP_046336035.1 | multidrug efflux RND transporter permease subunit | - |
| XBW1_RS04180 | 879580..879948 | + | 369 | WP_038191932.1 | Hha toxicity modulator TomB | Antitoxin |
| XBW1_RS04185 | 879996..880199 | + | 204 | WP_010845060.1 | hemolysin expression modulator Hha | Toxin |
| XBW1_RS23805 | 881186..881892 | + | 707 | WP_155399055.1 | IS1 family transposase | - |
| XBW1_RS04200 | 881918..882418 | + | 501 | WP_082243297.1 | thioesterase family protein | - |
| XBW1_RS04205 | 882476..883768 | - | 1293 | WP_046336037.1 | ammonium transporter AmtB | - |
| XBW1_RS04210 | 883784..884122 | - | 339 | WP_038191938.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8077.34 Da Isoelectric Point: 6.9770
>T284911 WP_010845060.1 NZ_FO818637:879996-880199 [Xenorhabdus bovienii]
MTKTDYLMRLRKCTSIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MTKTDYLMRLRKCTSIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14485.34 Da Isoelectric Point: 4.9443
>AT284911 WP_038191932.1 NZ_FO818637:879580-879948 [Xenorhabdus bovienii]
MDEYSPRRHDIVELKYLCENLIHEAFSVLNRADNHWINDLTSEKSLKLNELIEHIAAFVWSFKIKYADNYNLSTLIDEYL
DETYNLFGSDKISFFELTKWQKTNEHLTNILLHDLNACLSKT
MDEYSPRRHDIVELKYLCENLIHEAFSVLNRADNHWINDLTSEKSLKLNELIEHIAAFVWSFKIKYADNYNLSTLIDEYL
DETYNLFGSDKISFFELTKWQKTNEHLTNILLHDLNACLSKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N1NUC1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A077MYD9 |