Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 787698..788229 Replicon chromosome
Accession NZ_FO818637
Organism Xenorhabdus bovienii strain CS03

Toxin (Protein)


Gene name relE Uniprot ID A0A0B6X4T9
Locus tag XBW1_RS03630 Protein ID WP_046335942.1
Coordinates 787698..787979 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID A0A077NTI0
Locus tag XBW1_RS03635 Protein ID WP_038216894.1
Coordinates 787966..788229 (-) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
XBW1_RS03595 782930..783583 - 654 WP_038216874.1 DUF2612 domain-containing protein -
XBW1_RS03600 783576..784700 - 1125 WP_046335937.1 baseplate J/gp47 family protein -
XBW1_RS03605 784684..785043 - 360 WP_038216878.1 hypothetical protein -
XBW1_RS03610 785040..785705 - 666 WP_046335938.1 hypothetical protein -
XBW1_RS03615 785683..786531 - 849 WP_046335939.1 hypothetical protein -
XBW1_RS03620 786506..786844 - 339 WP_046335940.1 hypothetical protein -
XBW1_RS03625 786841..787596 - 756 WP_046335941.1 hypothetical protein -
XBW1_RS03630 787698..787979 - 282 WP_046335942.1 type II toxin-antitoxin system YafQ family toxin Toxin
XBW1_RS03635 787966..788229 - 264 WP_038216894.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
XBW1_RS03640 788348..788911 - 564 WP_082243293.1 phage antirepressor N-terminal domain-containing protein -
XBW1_RS03645 789159..789917 - 759 WP_046335943.1 antirepressor -
XBW1_RS23795 790106..790276 - 171 WP_080718388.1 Arc family DNA-binding protein -
XBW1_RS03650 790400..790840 + 441 WP_046335944.1 Arc family DNA-binding protein -
XBW1_RS03655 791264..791617 - 354 WP_038215239.1 hypothetical protein -
XBW1_RS03660 791614..791916 - 303 WP_038215241.1 hypothetical protein -
XBW1_RS03665 792185..792472 - 288 WP_155399069.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 750328..829420 79092


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-83)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10894.41 Da        Isoelectric Point: 6.8614

>T284910 WP_046335942.1 NZ_FO818637:c787979-787698 [Xenorhabdus bovienii]
MRTTDYTSQFKRDYKREKKGRHRETLDDALMTVTELLASDSLLEPKYCDHALSGDWKDFRDCHIKPDLILIYQKPDADIL
RLVRLGSHSELGL

Download         Length: 282 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9305.83 Da        Isoelectric Point: 5.0490

>AT284910 WP_038216894.1 NZ_FO818637:c788229-787966 [Xenorhabdus bovienii]
MATNQLIQTRIDGEIKAEAAAVLAAMGLTVSDAVRMMLTRVARDKILPFEPLIPNETTIAAMKEARKGGGKSFSSVKDLM
ADLNADD

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0B6X4T9

Antitoxin

Source ID Structure
AlphaFold DB A0A077NTI0

References