Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 323235..323772 | Replicon | chromosome |
| Accession | NZ_FO818637 | ||
| Organism | Xenorhabdus bovienii strain CS03 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A077N389 |
| Locus tag | XBW1_RS01455 | Protein ID | WP_038194741.1 |
| Coordinates | 323235..323528 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A077MRP5 |
| Locus tag | XBW1_RS01460 | Protein ID | WP_038194743.1 |
| Coordinates | 323518..323772 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| XBW1_RS01435 | 319399..319938 | + | 540 | WP_038207233.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| XBW1_RS01440 | 320295..320525 | + | 231 | WP_012986782.1 | ferrous iron transporter A | - |
| XBW1_RS01445 | 320590..322902 | + | 2313 | WP_046337811.1 | Fe(2+) transporter permease subunit FeoB | - |
| XBW1_RS01450 | 322912..323151 | + | 240 | WP_038194739.1 | ferrous iron transporter C | - |
| XBW1_RS01455 | 323235..323528 | - | 294 | WP_038194741.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| XBW1_RS01460 | 323518..323772 | - | 255 | WP_038194743.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| XBW1_RS01465 | 324068..324511 | + | 444 | WP_046335667.1 | OsmC family protein | - |
| XBW1_RS01470 | 324558..325334 | - | 777 | WP_038197660.1 | pimeloyl-ACP methyl ester esterase BioH | - |
| XBW1_RS01475 | 325373..326056 | + | 684 | WP_046335669.1 | DNA utilization protein GntX | - |
| XBW1_RS01480 | 326129..326704 | + | 576 | WP_038197662.1 | Fe-S biogenesis protein NfuA | - |
| XBW1_RS01485 | 326869..327192 | + | 324 | WP_038181767.1 | thiosulfate sulfurtransferase GlpE | - |
| XBW1_RS01490 | 327266..328099 | + | 834 | WP_038197663.1 | rhomboid family intramembrane serine protease GlpG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11498.47 Da Isoelectric Point: 10.1538
>T284909 WP_038194741.1 NZ_FO818637:c323528-323235 [Xenorhabdus bovienii]
MKFNIDFDERALKEWHKLDKSIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRSSGFRLVYQVIDEEIVIWVIAVG
KREDSMAYDIAKKRLGV
MKFNIDFDERALKEWHKLDKSIREQFKKKLRKLQENPYIESARLHGDLAGCFKIKLRSSGFRLVYQVIDEEIVIWVIAVG
KREDSMAYDIAKKRLGV
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A077N389 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A077MRP5 |