Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 158439..158989 | Replicon | chromosome |
Accession | NZ_FO818637 | ||
Organism | Xenorhabdus bovienii strain CS03 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A077PME5 |
Locus tag | XBW1_RS00735 | Protein ID | WP_038197671.1 |
Coordinates | 158699..158989 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A077MZK9 |
Locus tag | XBW1_RS00730 | Protein ID | WP_038197673.1 |
Coordinates | 158439..158711 (+) | Length | 91 a.a. |
Genomic Context
Location: 156126..158198 (2073 bp)
Type: Others
Protein ID: WP_046337796.1
Type: Others
Protein ID: WP_046337796.1
Location: 158439..158711 (273 bp)
Type: Antitoxin
Protein ID: WP_038197673.1
Type: Antitoxin
Protein ID: WP_038197673.1
Location: 158699..158989 (291 bp)
Type: Toxin
Protein ID: WP_038197671.1
Type: Toxin
Protein ID: WP_038197671.1
Location: 153738..154514 (777 bp)
Type: Others
Protein ID: WP_046335570.1
Type: Others
Protein ID: WP_046335570.1
Location: 154525..154812 (288 bp)
Type: Others
Protein ID: WP_038207257.1
Type: Others
Protein ID: WP_038207257.1
Location: 154857..155798 (942 bp)
Type: Others
Protein ID: WP_038197674.1
Type: Others
Protein ID: WP_038197674.1
Location: 158991..159312 (322 bp)
Type: Others
Protein ID: Protein_143
Type: Others
Protein ID: Protein_143
Location: 159309..159845 (537 bp)
Type: Others
Protein ID: WP_038207251.1
Type: Others
Protein ID: WP_038207251.1
Location: 159939..160977 (1039 bp)
Type: Others
Protein ID: Protein_145
Type: Others
Protein ID: Protein_145
Location: 161670..162764 (1095 bp)
Type: Others
Protein ID: WP_046335571.1
Type: Others
Protein ID: WP_046335571.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XBW1_RS00710 | 153738..154514 | - | 777 | WP_046335570.1 | phenylacetate-CoA oxygenase subunit PaaC | - |
XBW1_RS00715 | 154525..154812 | - | 288 | WP_038207257.1 | 1,2-phenylacetyl-CoA epoxidase subunit B | - |
XBW1_RS00720 | 154857..155798 | - | 942 | WP_038197674.1 | 1,2-phenylacetyl-CoA epoxidase subunit A | - |
XBW1_RS00725 | 156126..158198 | + | 2073 | WP_046337796.1 | phenylacetic acid degradation bifunctional protein PaaZ | - |
XBW1_RS00730 | 158439..158711 | + | 273 | WP_038197673.1 | CopG family ribbon-helix-helix protein | Antitoxin |
XBW1_RS00735 | 158699..158989 | + | 291 | WP_038197671.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
XBW1_RS23710 | 158991..159312 | - | 322 | Protein_143 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
XBW1_RS00740 | 159309..159845 | - | 537 | WP_038207251.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | - |
XBW1_RS00745 | 159939..160977 | - | 1039 | Protein_145 | IS630 family transposase | - |
XBW1_RS00750 | 161670..162764 | - | 1095 | WP_046335571.1 | aminotransferase class V-fold PLP-dependent enzyme | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10918.59 Da Isoelectric Point: 9.4808
>T284908 WP_038197671.1 NZ_FO818637:158699-158989 [Xenorhabdus bovienii]
MPRLIWSPAALTDVQKLYRFLVNKDEAAARRAIKTIRASVKILAHQPEVGRPAEDMDPVFREWLIDFGSSGYIALYRFDG
ETATILAVRHQKEAGY
MPRLIWSPAALTDVQKLYRFLVNKDEAAARRAIKTIRASVKILAHQPEVGRPAEDMDPVFREWLIDFGSSGYIALYRFDG
ETATILAVRHQKEAGY
Download Length: 291 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A077PME5 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A077MZK9 |