Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2929699..2930344 | Replicon | chromosome |
Accession | NZ_FO704551 | ||
Organism | Xenorhabdus poinarii G6 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A068R5W8 |
Locus tag | XPG1_RS13615 | Protein ID | WP_045959536.1 |
Coordinates | 2930171..2930344 (-) | Length | 58 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A068R6X7 |
Locus tag | XPG1_RS13610 | Protein ID | WP_045959535.1 |
Coordinates | 2929699..2930115 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XPG1_RS13595 | 2924724..2926472 | + | 1749 | WP_045959533.1 | DNA primase | - |
XPG1_RS13600 | 2926807..2928657 | + | 1851 | WP_045959534.1 | RNA polymerase sigma factor RpoD | - |
XPG1_RS13610 | 2929699..2930115 | - | 417 | WP_045959535.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
XPG1_RS13615 | 2930171..2930344 | - | 174 | WP_045959536.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
XPG1_RS17750 | 2930464..2930883 | - | 420 | WP_157879568.1 | hypothetical protein | - |
XPG1_RS13625 | 2930805..2931191 | + | 387 | WP_157879504.1 | type II toxin-antitoxin system HicB family antitoxin | - |
XPG1_RS13630 | 2931542..2932639 | + | 1098 | WP_071825386.1 | glycosyltransferase family 9 protein | - |
XPG1_RS13635 | 2932892..2934274 | + | 1383 | WP_045960769.1 | cysteine--tRNA ligase | - |
XPG1_RS17755 | 2934417..2934653 | - | 237 | WP_071825387.1 | stationary-phase-induced ribosome-associated protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 58 a.a. Molecular weight: 6652.78 Da Isoelectric Point: 11.1572
>T284907 WP_045959536.1 NZ_FO704551:c2930344-2930171 [Xenorhabdus poinarii G6]
VKQSEFRRWLEAQGVEVSNGTNHLKLKYQGKRSIMPRHPSQELKEPLRKAIIKQLGL
VKQSEFRRWLEAQGVEVSNGTNHLKLKYQGKRSIMPRHPSQELKEPLRKAIIKQLGL
Download Length: 174 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15469.59 Da Isoelectric Point: 4.3332
>AT284907 WP_045959535.1 NZ_FO704551:c2930115-2929699 [Xenorhabdus poinarii G6]
MRYPVTLEPVEEGGYFVSFPDIPEALTQGETREEALEMALDALITSFEFYFEDNEKIPLPRSVGRDDDYVDVPLSVASKV
LMLNAFVDSKLTQTELASRMGVKKQEVTRIFDLRHSTKIDTVGKVATAIGHQLTLSIE
MRYPVTLEPVEEGGYFVSFPDIPEALTQGETREEALEMALDALITSFEFYFEDNEKIPLPRSVGRDDDYVDVPLSVASKV
LMLNAFVDSKLTQTELASRMGVKKQEVTRIFDLRHSTKIDTVGKVATAIGHQLTLSIE
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068R5W8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068R6X7 |