Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2313075..2313868 | Replicon | chromosome |
Accession | NZ_FO704551 | ||
Organism | Xenorhabdus poinarii G6 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A068R4R5 |
Locus tag | XPG1_RS10705 | Protein ID | WP_045959072.1 |
Coordinates | 2313356..2313868 (+) | Length | 171 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | XPG1_RS10700 | Protein ID | WP_045960678.1 |
Coordinates | 2313075..2313359 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XPG1_RS10675 | 2308125..2308553 | + | 429 | WP_045959067.1 | EamA family transporter | - |
XPG1_RS10680 | 2308673..2310313 | - | 1641 | WP_045959068.1 | phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) | - |
XPG1_RS10685 | 2310428..2310961 | - | 534 | WP_045959069.1 | replication initiation negative regulator SeqA | - |
XPG1_RS10690 | 2311232..2312011 | + | 780 | WP_045959070.1 | esterase | - |
XPG1_RS10695 | 2312203..2312940 | + | 738 | WP_045959071.1 | class I SAM-dependent methyltransferase | - |
XPG1_RS10700 | 2313075..2313359 | + | 285 | WP_045960678.1 | DUF1778 domain-containing protein | Antitoxin |
XPG1_RS10705 | 2313356..2313868 | + | 513 | WP_045959072.1 | GNAT family N-acetyltransferase | Toxin |
XPG1_RS10710 | 2313937..2314764 | - | 828 | WP_045959073.1 | histidinol-phosphate aminotransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 171 a.a. Molecular weight: 18658.78 Da Isoelectric Point: 8.5068
>T284906 WP_045959072.1 NZ_FO704551:2313356-2313868 [Xenorhabdus poinarii G6]
MTVNLTEPEPLQHSHSIEAFCSGEESLDHWLKTRAMANQRSRASRTFVTCIDNQVMGYYALSTGVITTSQAVGRFKRNMP
SDIPIILLGRLAVDVKAKGMGIGRALVKDAALRVLQASGLVGVRGMVVHALSEEAKRFYEYIGFVPSPIDPMMLMITLTD
LQLAMGIHPN
MTVNLTEPEPLQHSHSIEAFCSGEESLDHWLKTRAMANQRSRASRTFVTCIDNQVMGYYALSTGVITTSQAVGRFKRNMP
SDIPIILLGRLAVDVKAKGMGIGRALVKDAALRVLQASGLVGVRGMVVHALSEEAKRFYEYIGFVPSPIDPMMLMITLTD
LQLAMGIHPN
Download Length: 513 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|