Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1371319..1371963 | Replicon | chromosome |
| Accession | NZ_FO704551 | ||
| Organism | Xenorhabdus poinarii G6 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A068R2A5 |
| Locus tag | XPG1_RS06340 | Protein ID | WP_045958322.1 |
| Coordinates | 1371778..1371963 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A068R4K5 |
| Locus tag | XPG1_RS06335 | Protein ID | WP_045958321.1 |
| Coordinates | 1371319..1371732 (-) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| XPG1_RS06295 | 1367079..1367408 | + | 330 | WP_045960298.1 | phage holin, lambda family | - |
| XPG1_RS06300 | 1367405..1367800 | + | 396 | WP_045958315.1 | structural protein | - |
| XPG1_RS17985 | 1367809..1368258 | + | 450 | WP_084717349.1 | lysis protein | - |
| XPG1_RS06310 | 1368255..1368479 | + | 225 | WP_045958317.1 | hypothetical protein | - |
| XPG1_RS06315 | 1368959..1369150 | + | 192 | WP_045960535.1 | hypothetical protein | - |
| XPG1_RS06320 | 1369198..1369434 | + | 237 | WP_045958318.1 | hypothetical protein | - |
| XPG1_RS17465 | 1369446..1370066 | + | 621 | WP_045958319.1 | terminase small subunit | - |
| XPG1_RS06330 | 1370047..1371276 | + | 1230 | WP_045958320.1 | PBSX family phage terminase large subunit | - |
| XPG1_RS06335 | 1371319..1371732 | - | 414 | WP_045958321.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| XPG1_RS06340 | 1371778..1371963 | - | 186 | WP_045958322.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| XPG1_RS06345 | 1372074..1373576 | + | 1503 | WP_045958323.1 | DUF1073 domain-containing protein | - |
| XPG1_RS06350 | 1373614..1374327 | + | 714 | WP_045958324.1 | head protein | - |
| XPG1_RS06355 | 1374324..1375607 | + | 1284 | WP_045958325.1 | DUF2213 domain-containing protein | - |
| XPG1_RS06360 | 1375607..1376104 | + | 498 | WP_045958326.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1346677..1389922 | 43245 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7062.30 Da Isoelectric Point: 10.9659
>T284905 WP_045958322.1 NZ_FO704551:c1371963-1371778 [Xenorhabdus poinarii G6]
MKSSELIKLLEKNGWVLDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQILKNAKLKN
MKSSELIKLLEKNGWVLDRIKGSHHQFTHPDFSFVVTVPHPRKDLKKGTLNQILKNAKLKN
Download Length: 186 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15345.19 Da Isoelectric Point: 4.5264
>AT284905 WP_045958321.1 NZ_FO704551:c1371732-1371319 [Xenorhabdus poinarii G6]
MLYPAFIEIDEDGSASGWFPDIDGCIFAGDSIEEAHADAISAINAHFELLSEKGFDIPSPKSQQTHLMNSINDYKNGVWF
LVDIDIDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
MLYPAFIEIDEDGSASGWFPDIDGCIFAGDSIEEAHADAISAINAHFELLSEKGFDIPSPKSQQTHLMNSINDYKNGVWF
LVDIDIDKYDGRAERINITLPHRLLSRIDTIVKTNPEYGSRSGFIATATRKELQKNI
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068R2A5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A068R4K5 |