Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 986875..987529 | Replicon | chromosome |
Accession | NZ_FO704551 | ||
Organism | Xenorhabdus poinarii G6 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A068R1A1 |
Locus tag | XPG1_RS04550 | Protein ID | WP_045958023.1 |
Coordinates | 987353..987529 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A068R3H8 |
Locus tag | XPG1_RS04545 | Protein ID | WP_045958022.1 |
Coordinates | 986875..987291 (-) | Length | 139 a.a. |
Genomic Context
Location: 984241..984636 (396 bp)
Type: Others
Protein ID: WP_045958017.1
Type: Others
Protein ID: WP_045958017.1
Location: 985287..985472 (186 bp)
Type: Others
Protein ID: WP_045958018.1
Type: Others
Protein ID: WP_045958018.1
Location: 985453..985992 (540 bp)
Type: Others
Protein ID: WP_045958019.1
Type: Others
Protein ID: WP_045958019.1
Location: 986116..986556 (441 bp)
Type: Others
Protein ID: WP_157879537.1
Type: Others
Protein ID: WP_157879537.1
Location: 986553..986777 (225 bp)
Type: Others
Protein ID: WP_045958021.1
Type: Others
Protein ID: WP_045958021.1
Location: 987637..988209 (573 bp)
Type: Others
Protein ID: WP_045958024.1
Type: Others
Protein ID: WP_045958024.1
Location: 988214..989833 (1620 bp)
Type: Others
Protein ID: WP_045958025.1
Type: Others
Protein ID: WP_045958025.1
Location: 989833..991521 (1689 bp)
Type: Others
Protein ID: WP_045958026.1
Type: Others
Protein ID: WP_045958026.1
Location: 991409..992131 (723 bp)
Type: Others
Protein ID: WP_173425860.1
Type: Others
Protein ID: WP_173425860.1
Location: 986875..987291 (417 bp)
Type: Antitoxin
Protein ID: WP_045958022.1
Type: Antitoxin
Protein ID: WP_045958022.1
Location: 987353..987529 (177 bp)
Type: Toxin
Protein ID: WP_045958023.1
Type: Toxin
Protein ID: WP_045958023.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XPG1_RS04520 | 984241..984636 | + | 396 | WP_045958017.1 | antitermination protein Q | - |
XPG1_RS04525 | 985287..985472 | + | 186 | WP_045958018.1 | phage holin family protein | - |
XPG1_RS04530 | 985453..985992 | + | 540 | WP_045958019.1 | lysozyme | - |
XPG1_RS17955 | 986116..986556 | + | 441 | WP_157879537.1 | lysis protein | - |
XPG1_RS04540 | 986553..986777 | + | 225 | WP_045958021.1 | hypothetical protein | - |
XPG1_RS04545 | 986875..987291 | - | 417 | WP_045958022.1 | transcriptional regulator | Antitoxin |
XPG1_RS04550 | 987353..987529 | - | 177 | WP_045958023.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
XPG1_RS04555 | 987637..988209 | + | 573 | WP_045958024.1 | terminase small subunit | - |
XPG1_RS04560 | 988214..989833 | + | 1620 | WP_045958025.1 | bacteriophage TerL protein | - |
XPG1_RS04565 | 989833..991521 | + | 1689 | WP_045958026.1 | DUF1073 domain-containing protein | - |
XPG1_RS04570 | 991409..992131 | + | 723 | WP_173425860.1 | minor capsid protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 966993..1018979 | 51986 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6650.82 Da Isoelectric Point: 10.6309
>T284904 WP_045958023.1 NZ_FO704551:c987529-987353 [Xenorhabdus poinarii G6]
VKQSEFLKWLKAHGVETENGKKHLKLYYKGKISHLPRHPSQELTTGLVEGIKKQLGLK
VKQSEFLKWLKAHGVETENGKKHLKLYYKGKISHLPRHPSQELTTGLVEGIKKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15639.00 Da Isoelectric Point: 4.3660
>AT284904 WP_045958022.1 NZ_FO704551:c987291-986875 [Xenorhabdus poinarii G6]
MYYPAEFVKEDNGYTVTFRDIPEAITCGTDMPEAMEMAEDVLLSCVEIYFDMDKNFPLPNSEIQEDEQWVYLPDSVYAKI
LLNNELLKANINKAELSRLTGIRPPEIQRILAPRHATKIDTISRAVAAIGKKLSLSVI
MYYPAEFVKEDNGYTVTFRDIPEAITCGTDMPEAMEMAEDVLLSCVEIYFDMDKNFPLPNSEIQEDEQWVYLPDSVYAKI
LLNNELLKANINKAELSRLTGIRPPEIQRILAPRHATKIDTISRAVAAIGKKLSLSVI
Download Length: 417 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068R1A1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068R3H8 |