Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 3726646..3727304 Replicon chromosome
Accession NZ_FO704550
Organism Xenorhabdus doucetiae strain FRM16

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag XDD1_RS16350 Protein ID WP_045972830.1
Coordinates 3726646..3726834 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A068QW81
Locus tag XDD1_RS16355 Protein ID WP_045972832.1
Coordinates 3726897..3727304 (+) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
XDD1_RS16320 3722026..3722313 + 288 WP_045972818.1 ribosome hibernation promoting factor -
XDD1_RS16325 3722474..3722941 + 468 WP_045972820.1 PTS IIA-like nitrogen regulatory protein PtsN -
XDD1_RS16330 3722982..3723833 + 852 WP_045972822.1 RNase adapter RapZ -
XDD1_RS16335 3723851..3724123 + 273 WP_045972824.1 PTS phosphocarrier protein NPr -
XDD1_RS16340 3724529..3725764 + 1236 WP_045972826.1 alanine racemase -
XDD1_RS16345 3725970..3726380 + 411 WP_045972828.1 nucleoside diphosphate kinase regulator -
XDD1_RS16350 3726646..3726834 + 189 WP_045972830.1 type II toxin-antitoxin system HicA family toxin Toxin
XDD1_RS16355 3726897..3727304 + 408 WP_045972832.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
XDD1_RS16360 3727358..3728701 - 1344 WP_045972834.1 metalloprotease PmbA -
XDD1_RS16365 3728900..3729436 + 537 WP_045972836.1 ribosome-associated protein -
XDD1_RS16370 3729619..3730572 + 954 WP_045972838.1 D-2-hydroxyacid dehydrogenase family protein -
XDD1_RS16375 3730867..3731118 + 252 WP_045972840.1 DUF1471 domain-containing protein -
XDD1_RS16380 3731216..3731677 - 462 WP_045972842.1 redox-sensitive transcriptional activator SoxR -
XDD1_RS16385 3731815..3732228 + 414 WP_045973748.1 DoxX family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-53)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 6835.05 Da        Isoelectric Point: 11.4350

>T284900 WP_045972830.1 NZ_FO704550:3726646-3726834 [Xenorhabdus doucetiae]
MSSTELIKRLMANGWIKDRQDGSHVTLTKPGVTKIITVPHPRKDASKGVIRQAQNISGLKLL

Download         Length: 189 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 15064.96 Da        Isoelectric Point: 4.3108

>AT284900 WP_045972832.1 NZ_FO704550:3726897-3727304 [Xenorhabdus doucetiae]
MIYPLFIFKAEDGFDGYFPDVEGCFFAGNTLEEAIRDAEKAFGQHMEVLTEQGGYVPAPKDPSGYINDSRLSEDGGVIAL
IELDPAKYESKAVKFNLTMPGNLLTAIDRYIEENGYYKNRSAFLAELARKEIAHP

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A068QW81

References