Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 3627619..3628264 | Replicon | chromosome |
Accession | NZ_FO704550 | ||
Organism | Xenorhabdus doucetiae strain FRM16 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | XDD1_RS19690 | Protein ID | WP_038268917.1 |
Coordinates | 3628088..3628264 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | XDD1_RS15795 | Protein ID | WP_038268972.1 |
Coordinates | 3627619..3628032 (-) | Length | 138 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XDD1_RS15780 | 3623880..3625727 | + | 1848 | WP_045972667.1 | RNA polymerase sigma factor RpoD | - |
XDD1_RS15785 | 3625784..3626563 | - | 780 | WP_045972669.1 | GNAT family N-acetyltransferase | - |
XDD1_RS15795 | 3627619..3628032 | - | 414 | WP_038268972.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
XDD1_RS19690 | 3628088..3628264 | - | 177 | WP_038268917.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
XDD1_RS15805 | 3628608..3630245 | - | 1638 | WP_045972671.1 | hypothetical protein | - |
XDD1_RS15810 | 3630232..3630777 | - | 546 | WP_045972673.1 | hypothetical protein | - |
XDD1_RS15815 | 3630749..3631477 | - | 729 | WP_045971827.1 | hypothetical protein | - |
XDD1_RS15820 | 3631477..3631902 | - | 426 | WP_045972675.1 | tail fiber assembly protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | rfaE | 3593314..3656355 | 63041 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6795.06 Da Isoelectric Point: 11.2836
>T284899 WP_038268917.1 NZ_FO704550:c3628264-3628088 [Xenorhabdus doucetiae]
VKQSEFRRWLESQGVKIKNGKNHLILLYGDARSAMPRHPSKEINEKLRLGILKQLKLK
VKQSEFRRWLESQGVKIKNGKNHLILLYGDARSAMPRHPSKEINEKLRLGILKQLKLK
Download Length: 177 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15075.23 Da Isoelectric Point: 4.4000
>AT284899 WP_038268972.1 NZ_FO704550:c3628032-3627619 [Xenorhabdus doucetiae]
MRYPVNIEEDGTNLFVSFPDIPEALTCGDDLADAKAMAYDALLTAFSMYFDDEDKEIPLPGHTVTEHYIDIPASVAAKIL
LLNAMVRSGVSRSELGRRVGIQKQNVKQLLDVYHATKIDTIEKALSSLGYELILTAA
MRYPVNIEEDGTNLFVSFPDIPEALTCGDDLADAKAMAYDALLTAFSMYFDDEDKEIPLPGHTVTEHYIDIPASVAAKIL
LLNAMVRSGVSRSELGRRVGIQKQNVKQLLDVYHATKIDTIEKALSSLGYELILTAA
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|