Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-higA/HigB-HigA |
Location | 3336851..3337699 | Replicon | chromosome |
Accession | NZ_FO704550 | ||
Organism | Xenorhabdus doucetiae strain FRM16 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A068QW26 |
Locus tag | XDD1_RS14510 | Protein ID | WP_045972272.1 |
Coordinates | 3337328..3337699 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | XDD1_RS14505 | Protein ID | WP_052705726.1 |
Coordinates | 3336851..3337324 (-) | Length | 158 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XDD1_RS14490 | 3331883..3333037 | - | 1155 | WP_045972266.1 | methionine adenosyltransferase | - |
XDD1_RS14495 | 3333467..3335371 | + | 1905 | WP_045972268.1 | biosynthetic arginine decarboxylase | - |
XDD1_RS14500 | 3335739..3336665 | + | 927 | WP_045972270.1 | agmatinase | - |
XDD1_RS14505 | 3336851..3337324 | - | 474 | WP_052705726.1 | transcriptional regulator | Antitoxin |
XDD1_RS14510 | 3337328..3337699 | - | 372 | WP_045972272.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
XDD1_RS14515 | 3337781..3338533 | - | 753 | WP_045972274.1 | 4'-phosphopantetheinyl transferase superfamily protein | - |
XDD1_RS14520 | 3338684..3339703 | + | 1020 | WP_045972276.1 | UDP-glucose 4-epimerase GalE | - |
XDD1_RS14525 | 3339806..3340894 | + | 1089 | WP_045972278.1 | UDP-glucose--hexose-1-phosphate uridylyltransferase | - |
XDD1_RS14530 | 3340933..3342087 | + | 1155 | WP_045972280.1 | galactokinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14835.25 Da Isoelectric Point: 10.3075
>T284898 WP_045972272.1 NZ_FO704550:c3337699-3337328 [Xenorhabdus doucetiae]
MRVITAKTITEAMQKHAQWKVGLKLWLDVFDKVSLRFESYAQIRELWLNTSTWNVDRVPYELLEAESKKGPLDIYVFDIH
KNKCRIITWLNPKSGTFYIKDVCPHSEYDKWWRKQTKSKRSKR
MRVITAKTITEAMQKHAQWKVGLKLWLDVFDKVSLRFESYAQIRELWLNTSTWNVDRVPYELLEAESKKGPLDIYVFDIH
KNKCRIITWLNPKSGTFYIKDVCPHSEYDKWWRKQTKSKRSKR
Download Length: 372 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17767.27 Da Isoelectric Point: 4.4249
>AT284898 WP_052705726.1 NZ_FO704550:c3337324-3336851 [Xenorhabdus doucetiae]
MRKTSLVTYEGIDGLIEILPQMMQSISEQLGPLALLFSACIEPVENDEDLNARMALIDELYSYAENTEHAAAKFADLITD
RVYEYEAKNRQVPNVIPREALSYFMREKGVRQIDLRDIASQSVISEILHGKRSMNIGQVKGFAQFFNVPVETFMGSD
MRKTSLVTYEGIDGLIEILPQMMQSISEQLGPLALLFSACIEPVENDEDLNARMALIDELYSYAENTEHAAAKFADLITD
RVYEYEAKNRQVPNVIPREALSYFMREKGVRQIDLRDIASQSVISEILHGKRSMNIGQVKGFAQFFNVPVETFMGSD
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|