Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 936350..936932 | Replicon | chromosome |
Accession | NZ_FO704550 | ||
Organism | Xenorhabdus doucetiae strain FRM16 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A068QNS5 |
Locus tag | XDD1_RS04445 | Protein ID | WP_045973327.1 |
Coordinates | 936350..936646 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | XDD1_RS04450 | Protein ID | WP_045969068.1 |
Coordinates | 936648..936932 (+) | Length | 95 a.a. |
Genomic Context
Location: 931436..931672 (237 bp)
Type: Others
Protein ID: WP_045969060.1
Type: Others
Protein ID: WP_045969060.1
Location: 931852..934488 (2637 bp)
Type: Others
Protein ID: WP_045969062.1
Type: Others
Protein ID: WP_045969062.1
Location: 935439..935768 (330 bp)
Type: Others
Protein ID: WP_038262604.1
Type: Others
Protein ID: WP_038262604.1
Location: 935909..936247 (339 bp)
Type: Others
Protein ID: WP_045969066.1
Type: Others
Protein ID: WP_045969066.1
Location: 936350..936646 (297 bp)
Type: Toxin
Protein ID: WP_045973327.1
Type: Toxin
Protein ID: WP_045973327.1
Location: 936648..936932 (285 bp)
Type: Antitoxin
Protein ID: WP_045969068.1
Type: Antitoxin
Protein ID: WP_045969068.1
Location: 934520..934945 (426 bp)
Type: Others
Protein ID: WP_045969064.1
Type: Others
Protein ID: WP_045969064.1
Location: 934945..935199 (255 bp)
Type: Others
Protein ID: WP_038262601.1
Type: Others
Protein ID: WP_038262601.1
Location: 936995..937378 (384 bp)
Type: Others
Protein ID: WP_045969070.1
Type: Others
Protein ID: WP_045969070.1
Location: 937705..938184 (480 bp)
Type: Others
Protein ID: WP_045969072.1
Type: Others
Protein ID: WP_045969072.1
Location: 938538..939859 (1322 bp)
Type: Others
Protein ID: Protein_855
Type: Others
Protein ID: Protein_855
Location: 940142..940564 (423 bp)
Type: Others
Protein ID: WP_045969076.1
Type: Others
Protein ID: WP_045969076.1
Location: 940561..940980 (420 bp)
Type: Others
Protein ID: WP_045969078.1
Type: Others
Protein ID: WP_045969078.1
Location: 941208..941432 (225 bp)
Type: Others
Protein ID: WP_197541013.1
Type: Others
Protein ID: WP_197541013.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XDD1_RS04415 | 931436..931672 | + | 237 | WP_045969060.1 | helix-turn-helix domain-containing protein | - |
XDD1_RS04420 | 931852..934488 | + | 2637 | WP_045969062.1 | host specificity protein J | - |
XDD1_RS04425 | 934520..934945 | - | 426 | WP_045969064.1 | type II toxin-antitoxin system VapC family toxin | - |
XDD1_RS04430 | 934945..935199 | - | 255 | WP_038262601.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
XDD1_RS04435 | 935439..935768 | + | 330 | WP_038262604.1 | type I toxin-antitoxin system SymE family toxin | - |
XDD1_RS04440 | 935909..936247 | + | 339 | WP_045969066.1 | SymE family type I addiction module toxin | - |
XDD1_RS04445 | 936350..936646 | + | 297 | WP_045973327.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
XDD1_RS04450 | 936648..936932 | + | 285 | WP_045969068.1 | putative addiction module antidote protein | Antitoxin |
XDD1_RS04455 | 936995..937378 | - | 384 | WP_045969070.1 | hypothetical protein | - |
XDD1_RS04460 | 937705..938184 | - | 480 | WP_045969072.1 | hypothetical protein | - |
XDD1_RS19715 | 938538..939859 | - | 1322 | Protein_855 | RHS repeat protein | - |
XDD1_RS04475 | 940142..940564 | - | 423 | WP_045969076.1 | hypothetical protein | - |
XDD1_RS04480 | 940561..940980 | - | 420 | WP_045969078.1 | hypothetical protein | - |
XDD1_RS19720 | 941208..941432 | - | 225 | WP_197541013.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 930472..962133 | 31661 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11258.93 Da Isoelectric Point: 7.9975
>T284896 WP_045973327.1 NZ_FO704550:936350-936646 [Xenorhabdus doucetiae]
MITIERTQDFEKWLKSLKDRIAKTKILIRVERMEEGNFGDVEPVGSGVSELKIHDGQGYRVYFANKNNEIILLLCGGDKS
SQQEDIKKAKQLAKEWGF
MITIERTQDFEKWLKSLKDRIAKTKILIRVERMEEGNFGDVEPVGSGVSELKIHDGQGYRVYFANKNNEIILLLCGGDKS
SQQEDIKKAKQLAKEWGF
Download Length: 297 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068QNS5 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |