Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/upstrm_HI1419-dnstrm_HI1420
Location 936350..936932 Replicon chromosome
Accession NZ_FO704550
Organism Xenorhabdus doucetiae strain FRM16

Toxin (Protein)


Gene name PumA Uniprot ID A0A068QNS5
Locus tag XDD1_RS04445 Protein ID WP_045973327.1
Coordinates 936350..936646 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag XDD1_RS04450 Protein ID WP_045969068.1
Coordinates 936648..936932 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
XDD1_RS04415 931436..931672 + 237 WP_045969060.1 helix-turn-helix domain-containing protein -
XDD1_RS04420 931852..934488 + 2637 WP_045969062.1 host specificity protein J -
XDD1_RS04425 934520..934945 - 426 WP_045969064.1 type II toxin-antitoxin system VapC family toxin -
XDD1_RS04430 934945..935199 - 255 WP_038262601.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
XDD1_RS04435 935439..935768 + 330 WP_038262604.1 type I toxin-antitoxin system SymE family toxin -
XDD1_RS04440 935909..936247 + 339 WP_045969066.1 SymE family type I addiction module toxin -
XDD1_RS04445 936350..936646 + 297 WP_045973327.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
XDD1_RS04450 936648..936932 + 285 WP_045969068.1 putative addiction module antidote protein Antitoxin
XDD1_RS04455 936995..937378 - 384 WP_045969070.1 hypothetical protein -
XDD1_RS04460 937705..938184 - 480 WP_045969072.1 hypothetical protein -
XDD1_RS19715 938538..939859 - 1322 Protein_855 RHS repeat protein -
XDD1_RS04475 940142..940564 - 423 WP_045969076.1 hypothetical protein -
XDD1_RS04480 940561..940980 - 420 WP_045969078.1 hypothetical protein -
XDD1_RS19720 941208..941432 - 225 WP_197541013.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 930472..962133 31661


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-92)

Antitoxin

Uncharacterized protein HI1420

(6-91)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11258.93 Da        Isoelectric Point: 7.9975

>T284896 WP_045973327.1 NZ_FO704550:936350-936646 [Xenorhabdus doucetiae]
MITIERTQDFEKWLKSLKDRIAKTKILIRVERMEEGNFGDVEPVGSGVSELKIHDGQGYRVYFANKNNEIILLLCGGDKS
SQQEDIKKAKQLAKEWGF

Download         Length: 297 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10502.92 Da        Isoelectric Point: 5.8648

>AT284896 WP_045969068.1 NZ_FO704550:936648-936932 [Xenorhabdus doucetiae]
MKSEPKKFDVVEFLETEDDIQAYLNAAIEENDTKYLFKALGNIARIKNISQLSKESGISREGIYKALSDEGNPSFNTVYK
ISKALGLKLHFTGA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A068QNS5

Antitoxin

Source ID Structure

References