Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 872940..873559 | Replicon | chromosome |
Accession | NZ_FO704550 | ||
Organism | Xenorhabdus doucetiae strain FRM16 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A068QNM5 |
Locus tag | XDD1_RS04160 | Protein ID | WP_045968972.1 |
Coordinates | 872940..873143 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A068QNR7 |
Locus tag | XDD1_RS04165 | Protein ID | WP_045968974.1 |
Coordinates | 873191..873559 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XDD1_RS04140 | 868383..868721 | + | 339 | WP_045968966.1 | P-II family nitrogen regulator | - |
XDD1_RS04145 | 868734..870014 | + | 1281 | WP_045968968.1 | ammonium transporter AmtB | - |
XDD1_RS04150 | 870093..870923 | - | 831 | WP_045968970.1 | acyl-CoA thioesterase II | - |
XDD1_RS04155 | 870920..871964 | - | 1045 | Protein_794 | IS630 family transposase | - |
XDD1_RS04160 | 872940..873143 | - | 204 | WP_045968972.1 | hemolysin expression modulator Hha | Toxin |
XDD1_RS04165 | 873191..873559 | - | 369 | WP_045968974.1 | Hha toxicity modulator TomB | Antitoxin |
XDD1_RS04170 | 874189..877338 | - | 3150 | WP_045968976.1 | multidrug efflux RND transporter permease subunit | - |
XDD1_RS04175 | 877353..878552 | - | 1200 | WP_045968978.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 870920..871579 | 659 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8033.33 Da Isoelectric Point: 7.9892
>T284895 WP_045968972.1 NZ_FO704550:c873143-872940 [Xenorhabdus doucetiae]
MTKTDYLMRLRKCTSIETLERVIEKNKYELSADELELFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MTKTDYLMRLRKCTSIETLERVIEKNKYELSADELELFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14430.29 Da Isoelectric Point: 5.4884
>AT284895 WP_045968974.1 NZ_FO704550:c873559-873191 [Xenorhabdus doucetiae]
MDEYSPRRHDVAELKYLCENLIHEAFSVLNRTDNHWIHDLTSEKSLKLNELIEHIAAFVWSFKIKYSDNYTLSTLIDNYL
DETYNLFGSDKISFLELTKWQKTNEHLTNILLHDLNAALSKI
MDEYSPRRHDVAELKYLCENLIHEAFSVLNRTDNHWIHDLTSEKSLKLNELIEHIAAFVWSFKIKYSDNYTLSTLIDNYL
DETYNLFGSDKISFLELTKWQKTNEHLTNILLHDLNAALSKI
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068QNM5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068QNR7 |