Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 795149..795788 | Replicon | chromosome |
Accession | NZ_FO704550 | ||
Organism | Xenorhabdus doucetiae strain FRM16 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | XDD1_RS03830 | Protein ID | WP_045968846.1 |
Coordinates | 795606..795788 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A068QNK7 |
Locus tag | XDD1_RS03825 | Protein ID | WP_045968844.1 |
Coordinates | 795149..795553 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XDD1_RS03810 | 790810..792432 | + | 1623 | WP_045968838.1 | peptide ABC transporter substrate-binding protein | - |
XDD1_RS03815 | 792570..793016 | - | 447 | WP_167541621.1 | VapA/VapB family virulence-associated protein | - |
XDD1_RS03820 | 793487..795109 | + | 1623 | WP_045968842.1 | peptide ABC transporter substrate-binding protein | - |
XDD1_RS03825 | 795149..795553 | - | 405 | WP_045968844.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
XDD1_RS03830 | 795606..795788 | - | 183 | WP_045968846.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
XDD1_RS03835 | 795881..799561 | - | 3681 | WP_045968848.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 7061.38 Da Isoelectric Point: 11.5111
>T284894 WP_045968846.1 NZ_FO704550:c795788-795606 [Xenorhabdus doucetiae]
MNSSDLMRLLEKNGWKLKRIKGSHHQFTHLEFSVVITVPHPRRDIKRGTLNKILKDAKIK
MNSSDLMRLLEKNGWKLKRIKGSHHQFTHLEFSVVITVPHPRRDIKRGTLNKILKDAKIK
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 15093.09 Da Isoelectric Point: 4.9289
>AT284894 WP_045968844.1 NZ_FO704550:c795553-795149 [Xenorhabdus doucetiae]
MLYPAFVEIDQDGSASGWFPDVAGCIFAGNTLEEAHSDAQSAINAHFELMKEQNLEFPFPKSMQEHLAEKAAEYQNGQWL
LIPVNMSQFEDKTERINITLPLRLINRIDAKVKQHPEYGSRSGFLALAARKALQ
MLYPAFVEIDQDGSASGWFPDVAGCIFAGNTLEEAHSDAQSAINAHFELMKEQNLEFPFPKSMQEHLAEKAAEYQNGQWL
LIPVNMSQFEDKTERINITLPLRLINRIDAKVKQHPEYGSRSGFLALAARKALQ
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|