Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 544945..545594 | Replicon | chromosome |
Accession | NZ_FO704550 | ||
Organism | Xenorhabdus doucetiae strain FRM16 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A068QR47 |
Locus tag | XDD1_RS02710 | Protein ID | WP_045968453.1 |
Coordinates | 544945..545334 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A068QNX2 |
Locus tag | XDD1_RS02715 | Protein ID | WP_045968455.1 |
Coordinates | 545334..545594 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XDD1_RS02700 | 540448..543750 | + | 3303 | WP_071827238.1 | hypothetical protein | - |
XDD1_RS02705 | 543737..544882 | + | 1146 | WP_045968450.1 | hypothetical protein | - |
XDD1_RS02710 | 544945..545334 | - | 390 | WP_045968453.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
XDD1_RS02715 | 545334..545594 | - | 261 | WP_045968455.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
XDD1_RS02720 | 545873..548050 | + | 2178 | WP_045968457.1 | indolepyruvate ferredoxin oxidoreductase subunit alpha | - |
XDD1_RS02725 | 548066..549622 | + | 1557 | WP_045968459.1 | indolepyruvate oxidoreductase subunit beta family protein | - |
XDD1_RS02730 | 549639..550058 | + | 420 | WP_045968461.1 | acyl-CoA thioesterase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14391.41 Da Isoelectric Point: 6.2212
>T284892 WP_045968453.1 NZ_FO704550:c545334-544945 [Xenorhabdus doucetiae]
MYMLDTNIVSYIFRQHPTVIAKLRTVSPSEIGISSITEAELRYGLARRQNSTLEHIVNTFIDSITVYDWDQNAAKVYGTL
RAGMEKTGRTMGTMDQLIAAHALSRGLTLVTSDSAFGMVSDLTIEDWTK
MYMLDTNIVSYIFRQHPTVIAKLRTVSPSEIGISSITEAELRYGLARRQNSTLEHIVNTFIDSITVYDWDQNAAKVYGTL
RAGMEKTGRTMGTMDQLIAAHALSRGLTLVTSDSAFGMVSDLTIEDWTK
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068QR47 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068QNX2 |