Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 524014..524591 | Replicon | chromosome |
Accession | NZ_FO704550 | ||
Organism | Xenorhabdus doucetiae strain FRM16 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A068QNH7 |
Locus tag | XDD1_RS02615 | Protein ID | WP_045968421.1 |
Coordinates | 524014..524346 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A068QR34 |
Locus tag | XDD1_RS02620 | Protein ID | WP_045968422.1 |
Coordinates | 524346..524591 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XDD1_RS18370 | 519402..520199 | - | 798 | WP_052705631.1 | DUF2829 domain-containing protein | - |
XDD1_RS02600 | 520521..521504 | + | 984 | WP_045968417.1 | IS30 family transposase | - |
XDD1_RS02605 | 521763..523052 | - | 1290 | WP_045968418.1 | bifunctional O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase | - |
XDD1_RS02610 | 523367..523945 | + | 579 | WP_045968419.1 | outer membrane beta-barrel protein | - |
XDD1_RS02615 | 524014..524346 | - | 333 | WP_045968421.1 | endoribonuclease MazF | Toxin |
XDD1_RS02620 | 524346..524591 | - | 246 | WP_045968422.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
XDD1_RS02625 | 524782..525675 | - | 894 | WP_045968425.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
XDD1_RS02630 | 526010..526384 | - | 375 | WP_045968427.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
XDD1_RS02635 | 526384..526656 | - | 273 | WP_045968429.1 | antitoxin | - |
XDD1_RS02640 | 526915..527703 | + | 789 | WP_045968431.1 | SDR family oxidoreductase | - |
XDD1_RS02645 | 527742..528986 | + | 1245 | WP_045968433.1 | hypothetical protein | - |
XDD1_RS02650 | 529035..529556 | + | 522 | WP_148886033.1 | flavin reductase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 520521..521504 | 983 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11996.76 Da Isoelectric Point: 7.2143
>T284891 WP_045968421.1 NZ_FO704550:c524346-524014 [Xenorhabdus doucetiae]
MVSRFVPDSGDIIWIDFDPVAGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKAKDYPFEVELSGSRDSIALADQVTCV
DWRARKVTKKGHVNSSELEDIKAKAKALIG
MVSRFVPDSGDIIWIDFDPVAGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKAKDYPFEVELSGSRDSIALADQVTCV
DWRARKVTKKGHVNSSELEDIKAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068QNH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068QR34 |