Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 506967..507718 | Replicon | chromosome |
Accession | NZ_FO704550 | ||
Organism | Xenorhabdus doucetiae strain FRM16 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | A0A068QR21 |
Locus tag | XDD1_RS02525 | Protein ID | WP_045968392.1 |
Coordinates | 506967..507455 (-) | Length | 163 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A068QNU9 |
Locus tag | XDD1_RS02530 | Protein ID | WP_045968394.1 |
Coordinates | 507446..507718 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XDD1_RS02505 | 502610..504034 | + | 1425 | WP_045968386.1 | sodium:proton antiporter | - |
XDD1_RS02510 | 504056..505048 | + | 993 | WP_045968388.1 | D-cysteine desulfhydrase | - |
XDD1_RS02515 | 505185..505757 | - | 573 | WP_084720912.1 | MFS transporter | - |
XDD1_RS02520 | 505707..506744 | + | 1038 | WP_045968390.1 | IS630 family transposase | - |
XDD1_RS18715 | 506751..506961 | + | 211 | Protein_472 | antitoxin | - |
XDD1_RS02525 | 506967..507455 | - | 489 | WP_045968392.1 | GNAT family N-acetyltransferase | Toxin |
XDD1_RS02530 | 507446..507718 | - | 273 | WP_045968394.1 | DUF1778 domain-containing protein | Antitoxin |
XDD1_RS02535 | 507923..508177 | + | 255 | WP_045968396.1 | antitoxin | - |
XDD1_RS02540 | 508174..508494 | + | 321 | WP_197540998.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
XDD1_RS02545 | 508620..508949 | - | 330 | WP_045968399.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
XDD1_RS02550 | 508918..509154 | - | 237 | WP_045968401.1 | hypothetical protein | - |
XDD1_RS02555 | 509605..510570 | + | 966 | WP_045968403.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
XDD1_RS02560 | 510710..510913 | + | 204 | WP_045968405.1 | hypothetical protein | - |
XDD1_RS02565 | 511088..511528 | - | 441 | WP_045968407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 510710..510913 | 203 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 163 a.a. Molecular weight: 18061.88 Da Isoelectric Point: 8.6772
>T284890 WP_045968392.1 NZ_FO704550:c507455-506967 [Xenorhabdus doucetiae]
MGINAPEILTAEHNINDFYCQHETLNEWLSRRALKNNKLGASRTFVICKEGTKDVIGYYCLSAGSINHIESTPSLKRNMP
DPIPVVLLGRLAVDVEYQGKKFGALLLQDAWKRVASMAEQVGISAIIVHALDENARTFYTRLGFTQSPLAPYTLMLPLGR
KN
MGINAPEILTAEHNINDFYCQHETLNEWLSRRALKNNKLGASRTFVICKEGTKDVIGYYCLSAGSINHIESTPSLKRNMP
DPIPVVLLGRLAVDVEYQGKKFGALLLQDAWKRVASMAEQVGISAIIVHALDENARTFYTRLGFTQSPLAPYTLMLPLGR
KN
Download Length: 489 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068QR21 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068QNU9 |