Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 128303..128919 Replicon chromosome
Accession NZ_FO704550
Organism Xenorhabdus doucetiae strain FRM16

Toxin (Protein)


Gene name doc Uniprot ID A0A068QM04
Locus tag XDD1_RS00585 Protein ID WP_045967828.1
Coordinates 128303..128701 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A068QM47
Locus tag XDD1_RS00590 Protein ID WP_045967830.1
Coordinates 128698..128919 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
XDD1_RS00560 124436..124978 - 543 WP_045967820.1 dihydrofolate reductase family protein -
XDD1_RS00565 124998..125945 - 948 WP_045967822.1 phenylacetic acid degradation operon negative regulatory protein PaaX -
XDD1_RS00570 126144..127031 - 888 WP_045967824.1 LysR family transcriptional regulator -
XDD1_RS00575 127032..128079 - 1048 Protein_96 IS630 family transposase -
XDD1_RS00585 128303..128701 - 399 WP_045967828.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
XDD1_RS00590 128698..128919 - 222 WP_045967830.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
XDD1_RS00595 129139..130002 - 864 WP_045967832.1 YicC family protein -
XDD1_RS00600 130126..130869 + 744 WP_045967834.1 ribonuclease PH -
XDD1_RS00605 130970..131611 + 642 WP_045967836.1 orotate phosphoribosyltransferase -
XDD1_RS00610 131873..132472 - 600 WP_045967838.1 nucleoid occlusion factor SlmA -
XDD1_RS00615 132632..133090 - 459 WP_045967840.1 dUTP diphosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(3-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-53)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14930.89 Da        Isoelectric Point: 5.5672

>T284889 WP_045967828.1 NZ_FO704550:c128701-128303 [Xenorhabdus doucetiae]
MIWVSAQEVIAFHDRILQRLPGVAGMPDSGRAEALIYRVQNRTHYEGITDIFELAATYWAAIARGHIFNDGNKRTAFFVT
MTFLYRNGIKILDNDNTLENLTVDAATGEKTVDQLAQHLRELVDYTNLSCNP

Download         Length: 399 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8084.95 Da        Isoelectric Point: 5.5589

>AT284889 WP_045967830.1 NZ_FO704550:c128919-128698 [Xenorhabdus doucetiae]
MRTYTSTQARANIAEVLDTAAHGEPVEITRRDGSSAVVISKAEFDAWQNAKLDAEFDAIMQRHGHTIEALTNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A068QM04

Antitoxin

Source ID Structure
AlphaFold DB A0A068QM47

References