Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 20904..21735 | Replicon | chromosome |
Accession | NZ_FO704550 | ||
Organism | Xenorhabdus doucetiae strain FRM16 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | A0A068QMN7 |
Locus tag | XDD1_RS00145 | Protein ID | WP_045967677.1 |
Coordinates | 20904..21449 (-) | Length | 182 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | A0A068QLX4 |
Locus tag | XDD1_RS00150 | Protein ID | WP_045967679.1 |
Coordinates | 21430..21735 (-) | Length | 102 a.a. |
Genomic Context
Location: 18282..18875 (594 bp)
Type: Others
Protein ID: WP_197540997.1
Type: Others
Protein ID: WP_197540997.1
Location: 18889..20337 (1449 bp)
Type: Others
Protein ID: WP_045967672.1
Type: Others
Protein ID: WP_045967672.1
Location: 20524..20850 (327 bp)
Type: Others
Protein ID: WP_045967675.1
Type: Others
Protein ID: WP_045967675.1
Location: 20904..21449 (546 bp)
Type: Toxin
Protein ID: WP_045967677.1
Type: Toxin
Protein ID: WP_045967677.1
Location: 21430..21735 (306 bp)
Type: Antitoxin
Protein ID: WP_045967679.1
Type: Antitoxin
Protein ID: WP_045967679.1
Location: 22061..24085 (2025 bp)
Type: Others
Protein ID: WP_045973257.1
Type: Others
Protein ID: WP_045973257.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
XDD1_RS00130 | 18282..18875 | + | 594 | WP_197540997.1 | rhomboid family intramembrane serine protease | - |
XDD1_RS00135 | 18889..20337 | - | 1449 | WP_045967672.1 | NAD(P)/FAD-dependent oxidoreductase | - |
XDD1_RS00140 | 20524..20850 | - | 327 | WP_045967675.1 | DUF305 domain-containing protein | - |
XDD1_RS00145 | 20904..21449 | - | 546 | WP_045967677.1 | GNAT family N-acetyltransferase | Toxin |
XDD1_RS00150 | 21430..21735 | - | 306 | WP_045967679.1 | DUF1778 domain-containing protein | Antitoxin |
XDD1_RS00155 | 22061..24085 | - | 2025 | WP_045973257.1 | protease Lon-related BREX system protein BrxL | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 182 a.a. Molecular weight: 19802.08 Da Isoelectric Point: 7.7415
>T284888 WP_045967677.1 NZ_FO704550:c21449-20904 [Xenorhabdus doucetiae]
MEKSLNEIRVEYICVNYQSDITYLGQKAFDCGNHVINRYVRSSLKSNVANGNCVAKALIDAETGELLGVCSFTGYSLAKS
RLSGVLSGSMPSDLSVIRLVMLGVSVKHQKKGYGHILMREFLEHAIKVHQVMPIKGIFLDADPDAVAFYILLGFVELGTP
ASNGTTPMFLKIQDLLAAIPY
MEKSLNEIRVEYICVNYQSDITYLGQKAFDCGNHVINRYVRSSLKSNVANGNCVAKALIDAETGELLGVCSFTGYSLAKS
RLSGVLSGSMPSDLSVIRLVMLGVSVKHQKKGYGHILMREFLEHAIKVHQVMPIKGIFLDADPDAVAFYILLGFVELGTP
ASNGTTPMFLKIQDLLAAIPY
Download Length: 546 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068QMN7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A068QLX4 |