Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 3913648..3914236 Replicon chromosome
Accession NZ_FO082820
Organism Pseudorhizobium banfieldiae strain NT-26

Toxin (Protein)


Gene name hicA Uniprot ID L0NLN7
Locus tag NT26_RS18875 Protein ID WP_052641024.1
Coordinates 3914054..3914236 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID L0NKV7
Locus tag NT26_RS18870 Protein ID WP_052641022.1
Coordinates 3913648..3914043 (-) Length 132 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NT26_RS18850 3908741..3909673 + 933 WP_052641014.1 tRNA pseudouridine(55) synthase TruB -
NT26_RS18855 3909828..3910097 + 270 WP_052641016.1 30S ribosomal protein S15 -
NT26_RS18860 3910401..3912554 + 2154 WP_052641018.1 polyribonucleotide nucleotidyltransferase -
NT26_RS18865 3912633..3913640 + 1008 WP_052641020.1 class I SAM-dependent methyltransferase -
NT26_RS18870 3913648..3914043 - 396 WP_052641022.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NT26_RS18875 3914054..3914236 - 183 WP_052641024.1 type II toxin-antitoxin system HicA family toxin Toxin
NT26_RS18880 3914314..3915120 - 807 WP_052641026.1 enoyl-ACP reductase FabI -
NT26_RS18885 3915126..3916349 - 1224 WP_052641028.1 beta-ketoacyl-ACP synthase I -
NT26_RS18890 3916392..3916907 - 516 WP_052641030.1 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA -
NT26_RS18895 3917211..3917627 + 417 WP_052641032.1 transcriptional repressor -
NT26_RS18900 3917633..3918271 - 639 WP_052641034.1 trimeric intracellular cation channel family protein -
NT26_RS18905 3918374..3918853 + 480 WP_052641036.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-124)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6684.95 Da        Isoelectric Point: 11.5372

>T284887 WP_052641024.1 NZ_FO082820:c3914236-3914054 [Pseudorhizobium banfieldiae]
MERNSQKILSRLKREGFELVSVKGSHHKLRKGTVTIIVPHPKKDLPLGTAKAIAKQAGWV

Download         Length: 183 bp

Antitoxin


Download         Length: 132 a.a.        Molecular weight: 14363.07 Da        Isoelectric Point: 4.3383

>AT284887 WP_052641022.1 NZ_FO082820:c3914043-3913648 [Pseudorhizobium banfieldiae]
MKHFIALVHKDHDSAFGVSFPDLPSVFSAADGEDDLVANATEALRLWSEDEVLPVPSSYEEIVSRDTVRDELAQGAFLIR
VPFIEDDSRVVRANVTFEKGMLDAIDAAARERGLTRSAFLASAARKEIEAA

Download         Length: 396 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB L0NLN7

Antitoxin

Source ID Structure
AlphaFold DB L0NKV7

References