Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09812-MazE |
Location | 2366768..2367393 | Replicon | chromosome |
Accession | NZ_FO082820 | ||
Organism | Pseudorhizobium banfieldiae strain NT-26 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | L0NH70 |
Locus tag | NT26_RS11590 | Protein ID | WP_052638970.1 |
Coordinates | 2367028..2367393 (+) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | L0NGH2 |
Locus tag | NT26_RS11585 | Protein ID | WP_052638969.1 |
Coordinates | 2366768..2367028 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NT26_RS11565 | 2362774..2364204 | - | 1431 | WP_052638965.1 | ribosome biogenesis GTPase Der | - |
NT26_RS11570 | 2364239..2364910 | - | 672 | WP_052638966.1 | tetratricopeptide repeat protein | - |
NT26_RS11575 | 2365009..2365593 | - | 585 | WP_052638967.1 | NnrU family protein | - |
NT26_RS11580 | 2365722..2366708 | + | 987 | WP_052638968.1 | polysaccharide deacetylase | - |
NT26_RS11585 | 2366768..2367028 | + | 261 | WP_052638969.1 | PbsX family transcriptional regulator | Antitoxin |
NT26_RS11590 | 2367028..2367393 | + | 366 | WP_052638970.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NT26_RS11595 | 2367739..2369016 | - | 1278 | WP_052638971.1 | peptide antibiotic transporter SbmA | - |
NT26_RS11600 | 2369165..2370349 | - | 1185 | WP_052642110.1 | YbfB/YjiJ family MFS transporter | - |
NT26_RS11605 | 2370449..2370796 | - | 348 | WP_052638972.1 | helix-turn-helix transcriptional regulator | - |
NT26_RS11610 | 2370906..2371637 | + | 732 | WP_052638973.1 | glutathione S-transferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13260.15 Da Isoelectric Point: 7.1656
>T284886 WP_052638970.1 NZ_FO082820:2367028-2367393 [Pseudorhizobium banfieldiae]
MIRSNVPKRGDVYWIDPNPVAGREMKNRHRYVVITPREINALGVSMTVPITTGGAFSREVGLAVPVTGHDTTGVAVCNQV
RSFDIQARIQQRTAQYIETLDEATMAEIVARVVSAIDPEPA
MIRSNVPKRGDVYWIDPNPVAGREMKNRHRYVVITPREINALGVSMTVPITTGGAFSREVGLAVPVTGHDTTGVAVCNQV
RSFDIQARIQQRTAQYIETLDEATMAEIVARVVSAIDPEPA
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|