Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 200559..201195 | Replicon | chromosome |
Accession | NZ_CP128552 | ||
Organism | Priestia aryabhattai strain XT37 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | D5DWT4 |
Locus tag | QUH71_RS01130 | Protein ID | WP_013055004.1 |
Coordinates | 200845..201195 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | D5DWT3 |
Locus tag | QUH71_RS01125 | Protein ID | WP_013055003.1 |
Coordinates | 200559..200840 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QUH71_RS01100 (QUH71_01100) | 195925..196896 | + | 972 | WP_033580801.1 | UV DNA damage repair endonuclease UvsE | - |
QUH71_RS01105 (QUH71_01105) | 196905..197507 | - | 603 | WP_028411882.1 | rhomboid family intramembrane serine protease | - |
QUH71_RS01110 (QUH71_01110) | 197572..197937 | + | 366 | WP_289578955.1 | holo-ACP synthase | - |
QUH71_RS01115 (QUH71_01115) | 197996..199054 | + | 1059 | WP_033580802.1 | outer membrane lipoprotein carrier protein LolA | - |
QUH71_RS01120 (QUH71_01120) | 199168..200358 | + | 1191 | WP_289578648.1 | alanine racemase | - |
QUH71_RS01125 (QUH71_01125) | 200559..200840 | + | 282 | WP_013055003.1 | hypothetical protein | Antitoxin |
QUH71_RS01130 (QUH71_01130) | 200845..201195 | + | 351 | WP_013055004.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QUH71_RS01135 (QUH71_01135) | 201353..202189 | + | 837 | WP_013055005.1 | RsbT co-antagonist protein RsbRA | - |
QUH71_RS01140 (QUH71_01140) | 202192..202548 | + | 357 | WP_013055006.1 | STAS domain-containing protein | - |
QUH71_RS01145 (QUH71_01145) | 202552..202953 | + | 402 | WP_013055007.1 | anti-sigma regulatory factor | - |
QUH71_RS01150 (QUH71_01150) | 202967..203977 | + | 1011 | WP_013055008.1 | PP2C family protein-serine/threonine phosphatase | - |
QUH71_RS01155 (QUH71_01155) | 204037..204369 | + | 333 | WP_013055009.1 | anti-sigma factor antagonist | - |
QUH71_RS01160 (QUH71_01160) | 204366..204851 | + | 486 | WP_025753516.1 | anti-sigma B factor RsbW | - |
QUH71_RS01165 (QUH71_01165) | 204817..205611 | + | 795 | WP_013055011.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12991.96 Da Isoelectric Point: 4.8781
>T284883 WP_013055004.1 NZ_CP128552:200845-201195 [Priestia aryabhattai]
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|